KEGG   Verminephrobacter eiseniae: Veis_3218Help
Entry
Veis_3218         CDS       T00460                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vei  Verminephrobacter eiseniae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:vei01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vei00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vei00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:vei00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:vei00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3591801..3593795
Genome map
AA seq 664 aa AA seqDB search
MSAPTSAIESVLIENRVFPPSDAIVNAARVSGMSGYEALCAEADQDIEGFWARQARSHLQ
WSRPFTRTLDASNAPFFQWFADGQLNASANCLDRHIGTPTEHKCAIIFEADDGTVTRISY
RELLARVGQFANALKAHGVAKGDRVLIYMPMTIEGVIAMQACARIGATHSVVFGGFSAKA
VHERIIDAGAVAVITANYQMRGGKELPLKAIIDQALALGGCDSVGTVFVHQRTASACPML
AGRDKTFAQALAGQSSDCAALALEAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAKMTMD
WTFDLRPDDIFWCTADIGWITGHTYVAYGPLAAGATQIIFEGIPTFPDAGRFWQMIERHR
CTIFYTAPTAIRSLIKAAEADAAVHPARSDLSSLRILGSVGEPINPEAWMWYHKNVGGER
CPIVDTFWQTETGGHVIAPLPGATPLVPGSCTLALPGIAAAVVDETGHDMPHGAGGILVI
KRPWPSMIRTIWNDPERFKKSYFPQELKGYYLAGDGAVRSTDRGYFRITGRIDDVLNVSG
HRMGTMEIESALVAKTDLVAEAAVVGRPDEVTGEAICAFVVLKRLRPTGEEARQIANELR
NWVAKEIGPIAKPRDIRFGDNLPKTRSGKIMRRLLRSIAKGEAITQDTSTLENPAILDQL
AQIN
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcccacatctgccatcgagtccgtgctgatcgaaaaccgcgtattcccaccg
tcggacgccatcgtcaacgcggcccgcgtgtccggcatgtccggctatgaggcgctgtgc
gccgaggccgaccaggatatcgagggcttctgggcgcgccaggcgcgcagccacctgcag
tggagccggcccttcacccgcacgctcgacgcatcgaatgcgccgtttttccagtggttt
gccgacggccagctcaatgcctcggccaattgcctggaccgccatatcggcacgccgacc
gagcacaaatgcgccatcatcttcgaggccgacgatggcacggtcacccgcatcagctac
cgcgagctgctcgcgcgcgtgggccagtttgccaatgcgctcaaagcccatggcgtggcc
aagggcgaccgggtcctgatctacatgccgatgaccatcgagggcgtgatcgcgatgcag
gcttgcgcccgcattggcgccacgcacagcgtggtgtttggcggcttcagcgccaaggcc
gtgcacgagcgcatcatcgacgccggcgccgtggccgtgatcactgccaactaccagatg
cgtggcggcaaggaactgcccctgaaagccatcatcgaccaggccctggccctgggtggc
tgcgacagcgttggcaccgtcttcgtccatcaacgcactgccagcgcctgcccgatgctg
gccgggcgcgacaagacctttgcccaggcgctcgcgggccagagcagcgactgcgccgcg
ctcgcgctggaggccgagcatccgctgttcatcctgtacaccagcggctccaccggcaag
cccaagggcgtgcagcacagcaccggcggctatctgctgtgggccaagatgactatggac
tggaccttcgacctgcgcccggacgacatcttctggtgcacggccgatatcggctggatc
accggccacacctacgtggcctatggcccgctggccgcaggcgcgacgcagatcatcttc
gagggcattcccacctttcccgacgcggggcgcttttggcagatgatcgagcggcacagg
tgcacgatcttctacaccgcccccacggccatccgctcgctgatcaaggccgccgaggcc
gacgctgcggtgcacccggcgcgctcggatctgagcagcctgcgcatcctgggcagcgtc
ggcgagccgatcaaccccgaagcctggatgtggtaccacaagaacgtgggcggcgagcgc
tgccccatcgtcgacaccttctggcagaccgaaaccggcggccatgtgatcgcgccgctg
cccggcgccaccccgctggtgcccggtagctgcacgctggcgctgcccggcatcgcggcc
gccgtggtcgatgaaacgggccacgacatgccccacggcgcgggcggcattctggtcatc
aagcgtccctggcccagcatgatccgcaccatctggaacgaccccgagcgcttcaaaaag
agctacttcccgcaggagctcaaaggctactacctggccggcgacggcgccgtgcgcagc
accgaccgtggctactttcgcatcaccggccgcatcgatgacgtgctcaacgtctcaggc
caccgcatgggcacgatggagatcgaatcggccctggtggccaagaccgacctggtggcc
gaggccgccgtggtcggccgccccgacgaggtgacgggcgaggccatctgcgccttcgtg
gtgctcaagcgcctgcgcccgaccggcgaagaggcccggcaaatcgccaacgagctgcgc
aactgggtggccaaggaaatcggcccgatcgccaagccccgggacatccgctttggcgac
aacctgcccaagacccgcagcggcaagatcatgcgccgcctgctgcgcagcattgccaag
ggcgaagccatcacgcaagacaccagcacgctggagaatccggccatcctcgatcaattg
gcccaaatcaactga

DBGET integrated database retrieval system