KEGG   Verminephrobacter eiseniae: Veis_3295Help
Entry
Veis_3295         CDS       T00460                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00010  Glycolysis / Gluconeogenesis
vei00071  Fatty acid degradation
vei00350  Tyrosine metabolism
vei00625  Chloroalkane and chloroalkene degradation
vei00626  Naphthalene degradation
vei01100  Metabolic pathways
vei01110  Biosynthesis of secondary metabolites
vei01120  Microbial metabolism in diverse environments
vei01130  Biosynthesis of antibiotics
vei01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Veis_3295
  Lipid metabolism
   00071 Fatty acid degradation
    Veis_3295
  Amino acid metabolism
   00350 Tyrosine metabolism
    Veis_3295
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Veis_3295
   00626 Naphthalene degradation
    Veis_3295
Enzymes [BR:vei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Veis_3295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 NADH_4Fe-4S UDPG_MGDP_dh_N ThiF
Motif
Other DBs
NCBI-ProteinID: ABM59025
JGI: Veis3295
UniProt: A1WN18
Position
3677638..3678762
Genome map
AA seq 374 aa AA seqDB search
MLIRSAVLHEMNAATPFAQTRPLRIEELELDEPGPGQVLVKMVAAGLCHSDLSVITGVRP
RPLPLALGHEASARVVRTGAGVTDLRAGDLVVLIFVPSCGHCMPCMQGRPALCEPAAEAN
GNGTLFGGDKRLRLRNTAVYHHTGVSAFSDHAVVSRQSCVKVDADIDPVQAAMFGCAVLT
GVGAVINTAGAQAGSTAALVGLGGVGLCALLAAVASGCRQVVAVDIHDSKLALARSLGAS
AAVNARDPDAVEQIRALTHGGVDYSFEMAGSVPSMETAYSITRRGGMTVTAGLPAPTDRW
PLRQLSLVVEERTVKGSYIGSCVPVRDVPRYIAMYLGGQLPIDRLMGQRHPLDDINAGFD
RLNSGESLRDVIVF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgctgatccgctctgccgtcttgcacgaaatgaacgccgcgacaccgttcgcgcaaacc
aggccactgcgcatcgaggagctcgagctcgacgagcccggcccgggccaggtgctggtg
aaaatggtggccgcgggcctgtgccactccgacctttcggtgatcaccggcgtgcggccg
cggcccttgccgctggcgctgggccacgaagcatcggcaagggtcgtcagaacgggcgcc
ggcgtgaccgatctgcgcgccggggatctggtggtactgatattcgtgccgagttgcggc
cattgcatgccctgtatgcaaggacgccccgcattgtgtgaaccggcggccgaagccaac
ggcaatggcactcttttcggcggcgacaaacgcctgcgcctgcgcaatacggcggtgtac
caccacaccggcgtttccgcgttctccgatcatgcggtggtttcgcgccaatcttgcgtg
aaggtcgacgccgacatcgaccccgtgcaagcggccatgttcggctgcgcggttctgacc
ggtgtgggggccgtgatcaacaccgcaggcgcgcaggcaggctcgacagcagcgctcgtg
ggattgggcggcgtcggcctgtgcgcgctgctggcggccgtggcctcgggctgcaggcag
gtcgtggccgtcgacatccatgacagcaaactggcgcttgcgcgcagcctgggcgccagc
gccgccgtcaatgcgcgcgatccggacgccgtcgagcagatccgcgcgttgacccacgga
ggcgtcgactattccttcgagatggccggctccgtgccctcgatggagaccgcgtacagc
atcacgcggcgcggcggcatgacggtcactgcgggcctgcccgccccgaccgatcgctgg
ccgctgcggcaactgagcctggtggtcgaggagcgcacggtcaaaggcagctacatcggc
tcctgcgtgccggtacgcgatgtgccgcgctacattgccatgtacctcggcggccagttg
ccgatcgatcgcctgatgggacagcgccacccactcgacgacatcaacgccggattcgat
cgcctgaacagcggcgagagcctgcgcgacgtgatcgtgttctga

DBGET integrated database retrieval system