KEGG   Verminephrobacter eiseniae: Veis_3403Help
Entry
Veis_3403         CDS       T00460                                 

Definition
carbamoyl-phosphate synthase L chain, ATP-binding
Orthology
K01965  
propionyl-CoA carboxylase alpha chain [EC:6.4.1.3]
Organism
vei  Verminephrobacter eiseniae
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:vei01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vei00630]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:vei00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:vei00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3772632..3774722
Genome map
AA seq 696 aa AA seqDB search
MATPPKFPRCTHHVMFNKILIANRGEIACRIIATARKMGIRSVAVYSDADKQARHTTLAD
EAVHIGPAPARASYLLAERIIAACRQTGAQAVHPGYGFLSENPDFARRCEEEGIVFIGPK
AHSIAAMGDKIASRKLAQAAGVHTIPGHNEAIGSPEQAREIARSIGYPVMIKASAGGGGK
GLRVAGNDQEVVEGFASCRSEARNSFGDERVFIEKFVQQPRHIEIQVLGDSHGNLIYLNE
RECSLQRRHQKVIEEAPSPFISDATRQAMGAQAVQLAKAVQYQSAGTVEFVVGKEQDFYF
LEMNTRLQVEHPVTECITGLDLVELMIRVAAGEKLPLTQAEVRRDGWAIECRINAEDPGR
NFLPSTGRLVRFLPPEPSLFQSDTSRRLGLRVDTGVYEGGEIPMHYDSMIAKLIVHGSDR
SDAIARMRAALDGFVIRGIRSNIPFQAAVLAHPKFVAGDFNTGFIAEHYGQGFDAQAVPH
EAPLFLVALAAYMNRRYRARASGISGQLAGHEVKVGEAFVVVVLDAQGQHRQHPVTVTDF
EDKSGSSAVAVADKSYQISSQATLGQIRVQGQCNGLDFTAQVERGVGKNPLALRIAHNGA
QIDALVLSPLGARLHQLMPFKAAPDLSRFLLSPMPGLLVDVAVQPGQKVQAGEKLAVIEA
MKMENILFAAQDAVVDKIVAGKGESLAVDQVILQFQ
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcccccgaagtttccacgctgcacccaccatgtcatgttcaacaaaatcctg
attgccaaccgcggcgaaatcgcctgccggatcatcgccaccgcccgcaagatgggaatc
cggagtgtggcggtttactccgatgccgacaaacaggcccgccacaccacactggccgac
gaggccgtgcacatcggtccggccccggcgcgcgcgtcctacctgctggccgagcggatc
attgccgcctgccggcagaccggcgcgcaggccgtgcaccccggctacggctttctttcg
gagaacccggactttgcccggcgctgcgaggaggagggcatcgtcttcatcggcccgaag
gcgcactcgatcgcggccatgggcgacaagattgcgtccaggaaactggcgcaggccgcc
ggggtccacaccatccccggccacaacgaggccatcggcagccccgagcaggcgcgggag
atcgcccgcagcatcggctacccggtgatgatcaaggccagcgccggcggcggcggcaag
ggcctgcgcgtggccggcaacgaccaggaggtggtcgagggctttgccagttgccgcagc
gaagcgcgcaacagctttggcgacgagcgcgtcttcatcgaaaaattcgtgcagcagccg
cgccacatcgagatccaggtgctcggcgacagccacggcaacctgatctatctgaacgag
cgcgaatgctcgctacagcggcgccaccagaaggtgatcgaggaggcgccatcgccgttc
atcagcgacgccacgcgccaggccatgggcgcgcaggccgtgcaactggccaaggccgtg
caataccagagcgcgggcacggtggaattcgtggtcggcaaggagcaggacttttacttt
ctggaaatgaacacccgcctgcaggtggagcacccggtgaccgaatgcatcaccggcctg
gacttggtggaactgatgatccgcgtggccgctggcgagaaactgccgttgacgcaggcc
gaggtcaggcgcgacggttgggccatcgagtgccgcatcaacgccgaagaccccgggcgc
aacttcctgccatcgaccggacgcctggtgcgctttttgccgccggagccaagcctgttc
cagtccgataccagccgcaggctgggcctgcgcgtcgacaccggcgtgtacgagggcggc
gagataccgatgcactacgactcgatgatcgccaagctcatcgtgcacggcagcgaccgc
agcgatgccatcgccaggatgcgcgctgcgctcgatggcttcgtgatccggggcatccgc
agcaatatcccgttccaggccgcagtgctggcccacccgaaattcgtggccggggacttc
aacaccggcttcattgccgagcactacggccagggcttcgacgcccaggcggtgccgcac
gaggccccgctgttcctggtggcgctggccgcctacatgaaccgccgctaccgcgcgcgc
gcctcgggcatcagcggccaactcgccggccacgaggtgaaggtcggcgaagccttcgtg
gtggtcgtcctggacgcgcaaggacagcaccggcagcacccggtgacggtgaccgacttt
gaagacaagtcgggctccagcgccgtagcggtggccgacaaaagctaccagatcagcagc
caggccacgctgggccagatccgcgtgcaaggccagtgcaatggcctggactttaccgcc
caggtcgagcgcggcgtgggcaagaacccgctggcgctgcgcattgcgcacaacggcgcg
cagatcgacgccctggtgctgtcgccgctgggcgcgcgcctgcaccaactgatgcccttc
aaggccgcgcccgacctctcccggttcctgctgtcgcccatgcccggcctgttggtcgat
gtggccgtgcagcccggccagaaggtgcaggccggtgaaaaactggccgtgatcgaggcc
atgaagatggaaaacatcctctttgccgcgcaggacgcggtggtggacaaaatcgtcgcc
ggcaagggcgaatcgctggcggtggatcaggtcatcttgcagtttcagtga

DBGET integrated database retrieval system