KEGG   Verminephrobacter eiseniae: Veis_3412Help
Entry
Veis_3412         CDS       T00460                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vei  Verminephrobacter eiseniae
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Veis_3412
Enzymes [BR:vei01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Veis_3412
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Veis_3412
Lipid biosynthesis proteins [BR:vei01004]
 Fatty acid synthase
  Component type
   Veis_3412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3783063..3783611)
Genome map
AA seq 182 aa AA seqDB search
MLVLGDSLSAEYGLARGTGWVALLEQQLRQERPQVTVLNASVSGETTSGGRSRLAALLAQ
HQPSHVVIELGGNDALRGLPLKSIEENLDWMTRTAQQAGAKVLLLGMQVPPNYGAAYADR
FAALFTTVAQARKAAVVPFLLKGVADGPDPTRLFQPDRIHPRAEAQPQLLANVWPELKKL
LQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtgctgggcgactcgctcagcgccgaatacggcctggcacgcggcacgggttgg
gtggcactgctggagcagcaattgcggcaggagcgaccccaggtcaccgtgctcaacgcc
agcgtcagcggcgagaccacatcgggcggacgctcacgccttgcggccttgctggcgcag
caccagcccagccatgtggtgatcgagctcggcggcaatgatgcgctgcgcggactgcct
ttgaaaagcatcgaagagaacctggactggatgacccggacggcgcagcaggccggcgca
aaagtcctgctgctgggcatgcaggtgccgcccaactatggcgccgcttacgccgaccgg
tttgcggccttgttcaccacggtagcgcaggcccgcaaggccgcagtggtgccttttttg
ctcaaaggggtggccgacgggccggacccgacccgcctgttccagccagaccgcatccac
ccgcgcgccgaagcgcagccgcagttgctggccaatgtgtggccggaactgaaaaaactg
ttgcagtga

DBGET integrated database retrieval system