KEGG   Verminephrobacter eiseniae: Veis_3495Help
Entry
Veis_3495         CDS       T00460                                 

Definition
(GenBank) CoA-binding domain protein
Organism
vei  Verminephrobacter eiseniae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3865547..3867682)
Genome map
AA seq 711 aa AA seqDB search
MNLHAGTASRLHLAPRQTVRQILHPTSVAIVGASDSQDKWGGRLLRYMLRHHHGGALYPI
NARATELMGLPAYRTLPDCPAAVDLAILLVPREHVYAAIEDCVEKEVGCALCITAGFAET
GPKGCADEQALVALARAGGVRLIGPNCMGLMNTHHRLCATTAVVMGGIDTLPAGGIGLAS
QSGALMGAMISRGVDIGTGFSSTISVGNQSDLDLNDFFEYLIDDPMTDVVCLYMEAVKDA
PRFTALLARAAAVRKPVCIVKSGRSEAGARAAASHTASLAGAWPAFEAICRRWGVYLFET
IYDLLQGAQLLQRGKRVESRGVAVTSGSGGAGALLADALEAHGLELPILSDATQLAVQSV
LPASHRQLPFDFGMLNHLSPPDPEVGGGSVGIALDRVMADPAIGAGIVLLTTQPQQERVA
TAAILVADRSSKPLLFVQGAGNHGDIARQMLRAAGHGYFDSPHDALKVLAALASRTEPAV
AAGLLPDGGIPADLPSGFLTEPDARRLLEANGIPTTRWQFAADPEGAVRAARGIGTLVAI
KAVSAKIVHKSDIGGVRLSVQGDEAVRAACTAIAEAARRAGVQALDGYLVTEMWRADFEL
ILGIRHDPDFGALVMVGAGGLLVELMKDVQLAPAPLSQAAALQMLGALKSRALLAGYRGR
PAADVDAIADMLVRLGSLAASSRGRLRELDINPLLVNGARIAAADARATLG
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttcacgccggcacggcatcccgtctccatctggcaccccggcaaacggtgcgc
cagatcctgcacccgacctcggtggccatcgtcggcgcgtccgacagccaagacaaatgg
ggtgggcgcctgctgcgctacatgctcaggcaccaccatggcggtgccctttacccgatc
aacgcgcgcgccaccgaactcatggggctgccagcctaccgcacactgccggattgcccc
gctgcggtggacctggccatcctgctcgtccccagggagcatgtgtacgccgccatcgaa
gactgtgtcgaaaaagaggtcgggtgtgccctttgcatcactgccggtttcgcggaaaca
ggcccgaaagggtgcgctgacgagcaagcgctggtcgcactcgcgcgcgccggcggggtg
cggctgatcggccccaactgcatggggctgatgaatacccaccaccgtctgtgcgccacc
acggcagtggtcatgggcggcatcgacacattgcctgcgggcgggatcggcctggccagc
cagagcggtgcgctgatgggggccatgatctcgcgcggcgtggacatcggcacaggtttt
tcgagcacgatttcggtaggcaaccagagcgatctggacctcaatgacttttttgaatac
ctgatcgacgatccgatgacggatgtcgtctgcctctacatggaagcggtcaaggacgcc
ccacgctttacggcgttgctggcccgggccgcagcggtccgcaagccagtgtgcatcgtc
aagtccggacgcagcgaagcgggcgcgcgtgccgccgcctcgcatacggccagtttggcg
ggcgcctggcccgctttcgaggccatctgccgacgctggggggtctaccttttcgagacc
atctacgacctgttgcaaggcgcccaactgctgcagcggggcaagcgggtcgaatcgcgc
ggcgtggccgtgacgtccggctcgggcggcgcaggtgcgctgctggccgacgcgctggag
gcccatggcctggagttgccgatcctgtccgatgccacgcagcttgccgtgcaaagcgtc
ctgcccgcatcgcaccgacagttgccgttcgacttcggcatgctcaaccacctgtcgccc
ccggatcccgaggtcggcggcggctcggtcgggattgcgctcgaccgtgtgatggcggac
cccgcaataggcgccggcatcgtgttgctcaccacgcaacctcagcaagagcgcgtggcc
accgccgccattttggtcgccgaccgcagcagcaaacccctgctgttcgtgcaaggggca
ggcaaccacggcgacatcgcgcgccagatgctgcgcgcagccggacacggctatttcgat
agcccgcacgacgcgctgaaagtgctggcggcgctggccagcagaaccgagccggcagtt
gccgccgggttgctgcccgacggcggcattccagccgatctgccctcgggctttctgacc
gagcccgacgcacgtcgcctgctggaggccaacggcattcccaccacgcgctggcaattt
gccgccgaccctgaaggcgcagtgcgggcagcgcgcggcatcggtactttggtcgccatc
aaggccgtgagcgcaaagatcgtccacaagagcgacatcggtggcgtgcgcctgagcgta
cagggcgacgaagccgtgcgcgccgcttgcaccgccattgccgaggccgcgcgcagggcg
ggcgttcaggcgctggacggctacctcgtcaccgaaatgtggcgtgccgacttcgagctg
attcttggaatccggcatgacccggattttggcgcgctggtgatggtcggcgcgggcggc
ctgttggtggaactgatgaaggacgttcagctcgcgcccgcgccactctcgcaggccgcc
gctttgcagatgctcggggcgctcaagagccgcgcgctgctggccggttacagaggccgg
ccggccgccgatgtggacgccattgcggacatgctggtgcggctgggttcgctggccgca
tcttcgcggggccgattgcgcgaactggacatcaacccgctgctcgtcaatggcgcccgg
attgccgccgccgacgcgcgcgcgacgctgggctga

DBGET integrated database retrieval system