KEGG   Verminephrobacter eiseniae: Veis_3495Help
Entry
Veis_3495         CDS       T00460                                 

Definition
CoA-binding domain-containing protein
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
vei  Verminephrobacter eiseniae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vei00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vei00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:vei00640]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3865547..3867682)
Genome map
AA seq 711 aa AA seqDB search
MNLHAGTASRLHLAPRQTVRQILHPTSVAIVGASDSQDKWGGRLLRYMLRHHHGGALYPI
NARATELMGLPAYRTLPDCPAAVDLAILLVPREHVYAAIEDCVEKEVGCALCITAGFAET
GPKGCADEQALVALARAGGVRLIGPNCMGLMNTHHRLCATTAVVMGGIDTLPAGGIGLAS
QSGALMGAMISRGVDIGTGFSSTISVGNQSDLDLNDFFEYLIDDPMTDVVCLYMEAVKDA
PRFTALLARAAAVRKPVCIVKSGRSEAGARAAASHTASLAGAWPAFEAICRRWGVYLFET
IYDLLQGAQLLQRGKRVESRGVAVTSGSGGAGALLADALEAHGLELPILSDATQLAVQSV
LPASHRQLPFDFGMLNHLSPPDPEVGGGSVGIALDRVMADPAIGAGIVLLTTQPQQERVA
TAAILVADRSSKPLLFVQGAGNHGDIARQMLRAAGHGYFDSPHDALKVLAALASRTEPAV
AAGLLPDGGIPADLPSGFLTEPDARRLLEANGIPTTRWQFAADPEGAVRAARGIGTLVAI
KAVSAKIVHKSDIGGVRLSVQGDEAVRAACTAIAEAARRAGVQALDGYLVTEMWRADFEL
ILGIRHDPDFGALVMVGAGGLLVELMKDVQLAPAPLSQAAALQMLGALKSRALLAGYRGR
PAADVDAIADMLVRLGSLAASSRGRLRELDINPLLVNGARIAAADARATLG
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttcacgccggcacggcatcccgtctccatctggcaccccggcaaacggtgcgc
cagatcctgcacccgacctcggtggccatcgtcggcgcgtccgacagccaagacaaatgg
ggtgggcgcctgctgcgctacatgctcaggcaccaccatggcggtgccctttacccgatc
aacgcgcgcgccaccgaactcatggggctgccagcctaccgcacactgccggattgcccc
gctgcggtggacctggccatcctgctcgtccccagggagcatgtgtacgccgccatcgaa
gactgtgtcgaaaaagaggtcgggtgtgccctttgcatcactgccggtttcgcggaaaca
ggcccgaaagggtgcgctgacgagcaagcgctggtcgcactcgcgcgcgccggcggggtg
cggctgatcggccccaactgcatggggctgatgaatacccaccaccgtctgtgcgccacc
acggcagtggtcatgggcggcatcgacacattgcctgcgggcgggatcggcctggccagc
cagagcggtgcgctgatgggggccatgatctcgcgcggcgtggacatcggcacaggtttt
tcgagcacgatttcggtaggcaaccagagcgatctggacctcaatgacttttttgaatac
ctgatcgacgatccgatgacggatgtcgtctgcctctacatggaagcggtcaaggacgcc
ccacgctttacggcgttgctggcccgggccgcagcggtccgcaagccagtgtgcatcgtc
aagtccggacgcagcgaagcgggcgcgcgtgccgccgcctcgcatacggccagtttggcg
ggcgcctggcccgctttcgaggccatctgccgacgctggggggtctaccttttcgagacc
atctacgacctgttgcaaggcgcccaactgctgcagcggggcaagcgggtcgaatcgcgc
ggcgtggccgtgacgtccggctcgggcggcgcaggtgcgctgctggccgacgcgctggag
gcccatggcctggagttgccgatcctgtccgatgccacgcagcttgccgtgcaaagcgtc
ctgcccgcatcgcaccgacagttgccgttcgacttcggcatgctcaaccacctgtcgccc
ccggatcccgaggtcggcggcggctcggtcgggattgcgctcgaccgtgtgatggcggac
cccgcaataggcgccggcatcgtgttgctcaccacgcaacctcagcaagagcgcgtggcc
accgccgccattttggtcgccgaccgcagcagcaaacccctgctgttcgtgcaaggggca
ggcaaccacggcgacatcgcgcgccagatgctgcgcgcagccggacacggctatttcgat
agcccgcacgacgcgctgaaagtgctggcggcgctggccagcagaaccgagccggcagtt
gccgccgggttgctgcccgacggcggcattccagccgatctgccctcgggctttctgacc
gagcccgacgcacgtcgcctgctggaggccaacggcattcccaccacgcgctggcaattt
gccgccgaccctgaaggcgcagtgcgggcagcgcgcggcatcggtactttggtcgccatc
aaggccgtgagcgcaaagatcgtccacaagagcgacatcggtggcgtgcgcctgagcgta
cagggcgacgaagccgtgcgcgccgcttgcaccgccattgccgaggccgcgcgcagggcg
ggcgttcaggcgctggacggctacctcgtcaccgaaatgtggcgtgccgacttcgagctg
attcttggaatccggcatgacccggattttggcgcgctggtgatggtcggcgcgggcggc
ctgttggtggaactgatgaaggacgttcagctcgcgcccgcgccactctcgcaggccgcc
gctttgcagatgctcggggcgctcaagagccgcgcgctgctggccggttacagaggccgg
ccggccgccgatgtggacgccattgcggacatgctggtgcggctgggttcgctggccgca
tcttcgcggggccgattgcgcgaactggacatcaacccgctgctcgtcaatggcgcccgg
attgccgccgccgacgcgcgcgcgacgctgggctga

DBGET integrated database retrieval system