KEGG   Verminephrobacter eiseniae: Veis_3609Help
Entry
Veis_3609         CDS       T00460                                 

Definition
phosphoribosylformylglycinamidine synthase (EC:6.3.5.3)
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
vei  Verminephrobacter eiseniae
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Veis_3609
Enzymes [BR:vei01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     Veis_3609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3988614..3992615)
Genome map
AA seq 1333 aa AA seqDB search
MTTLAGGNALSPFRARQLQSALADIHPGITGIAARFVHLVLTDTAPAPAQQQRLAALLRY
GDPYAGPVDGCAIIVTPRLGTLSPWASKATDIARNCGLAVRHLERSTEYRIRLRAGRLTD
AERDRIAALLHDRMTESVLFDPAGLAALFTALPPARMEHVDVLGAGLAALAAANTRLGLA
LADQEMEYLVSAFTGLARNPTEVELMMFAQANSEHCRHKIFNARFAIDGVAQEPSLFDMI
RHTHQRAPGHTLVAYSDNAAVMQGHLVEQFAAKMTDGADPSCAHTYAYSYQKSSSTEHLL
MKVETHNHPTAISPWPGAATGAGGEIRDEGATGRGARPRAGLTGFSVSRLWGSQIGRPGH
IASALQIMLEGPLGAAAFNNEFGRPNLAGYFREYEQRVGCGADAVVRGYHKPIMLAGGLG
VIDAALVRKIAFPAGTLLVQLGGPGMRIGMGGGAASSMATGSNAAGLDFDSVQRGNPEIQ
RRAQEVINHCAAQGAANPILAIHDVGAGGLSNALPELIHDAGRGARLDLRAVPLEDSGMS
AMEIWSNESQERYVLAIAPESLAQLRSFCERERCPLAVLGSATEERQLVLHDSAATAADQ
QLPVNLPMGVLLGQPPRMQRNASSLRRRFVPLDLSGLPLHKAVTDVLAHPTVASKRFLVS
IGDRTVGGLVHRDQMVGPWQVPVADCAITLADYQGFAGAAMAIGERTPLAALDAPASGRM
AVAEAITNLLAAPIELARVKLSANWMAACGEPGEDAALYATVEAVGLELCPALGLAIPVG
KDSLSMRTQWREGAGQTTVSSPVSLIVSAFAALTDVRGSLTPQLDATEAETTLVLIDLGR
GRNRMGASILGQTLEQSGCPEKDGVPDLDAPQDLLALVDAVNALRAQGRLLAYHDRSDGG
LLATVAEMAFAGQVGVALNVDLLVTEGDGIGDSRMDTGDAKNWAGQVHARREERTLEALF
SEELGVVLQVRTAERNEVMQTLRAHGLARWSHFIGSTRPAGPRVLQVWRDAQPVFSAPLA
DLQRAWDTVSWKICRQRDNPDSADAEHAAAGDPTDPGLHLHLQPTFDAPEPPAAPGLRLA
RPRVAILREQGVNSHVEMAYAFTEAGFAACDVHMTDLQTGRVRLADFKGLVACGGFSYGD
TLGAGIGWARSISFNPALAAQFQGFFARGDTFGLGVCNGCQMFAELADIIPGAQYWPRFT
TNQSQRFESRLSLVQVTESPSLFLQGMAGSRLPVPVAHGEGYADFRQRGDAAQAIAALRF
VDNHGAVTERYPFNPNGSPGGLTGVTTADGRFTALMPHPERVFRNIQMSWTPGERSALSP
WMRLWRNARRWVG
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctggcgggcggcaacgccctcagcccctttcgcgcccgacaactgcaatcc
gcgctggcggacattcaccccggcatcaccggcatcgcagcgcgcttcgtgcatctggtg
ctcaccgataccgcccctgcgcccgcgcagcagcagcgcctggcggccttgctgcgctac
ggcgacccttacgccggccccgtcgatggctgcgccatcatcgtcaccccgcgcctgggc
accttgtcgccctgggcgtccaaggccaccgacattgcgcgcaactgcggcctggccgtg
cgccatctggagcgcagcaccgaataccgcatccgcctgcgggcgggccggctgaccgat
gccgagcgcgaccggatagccgccttgctgcatgaccgcatgaccgagtcggtgctgttc
gacccggctggcctggcggcgctgttcactgcgctgccaccggcccgcatggagcatgtg
gatgtgctcggcgccggcctggcggcgctggcagcggccaacacccgcttgggcctggcc
ctggccgatcaggagatggagtacctggtcagcgccttcaccggcctggcgcgcaacccc
accgaggtcgaactgatgatgttcgcgcaggccaacagcgagcattgccggcacaagata
ttcaacgcgcgctttgccatcgacggcgtggcgcaggagccaagcctgttcgacatgatc
cgccacacgcaccagcgcgcgcccgggcacacgctggtcgcgtactcggacaacgccgcc
gtgatgcaaggccacctggtcgagcaatttgccgcaaaaatgaccgatggcgcagaccca
tcatgcgcccatacatacgcctacagctatcaaaaaagtagctccaccgagcatttgctg
atgaaggtggaaacgcacaaccaccccacggcgatctcgccctggcccggcgcagccacc
ggcgccggcggtgaaatccgcgacgagggcgccaccggccggggcgcccggcccagggcg
gggctgacgggctttagcgtgtcccggctatggggcagccagatcggccgacccgggcac
attgccagcgcgctgcagatcatgctcgaaggccccttgggcgctgccgcgttcaacaac
gaattcggacgcccgaatctggcgggctactttcgcgaatacgagcagcgcgtgggttgc
ggcgctgacgccgtggtgcgcggctaccacaagcccatcatgctcgccggcggtctgggc
gtgatcgatgccgcgctggtcagaaaaattgcctttcccgccggcacactgctggtgcaa
ctgggcgggccgggcatgcgcatcggcatgggcggcggcgcggccagttcgatggccacg
ggcagcaatgcggccgggctggacttcgactcggtgcagcgcggcaaccccgagatccag
cgccgggcgcaagaggtcatcaaccactgcgcggcgcagggcgcggccaaccccattttg
gcgattcacgatgtgggcgcgggcggcctgtccaacgccttgccggaactgatccacgac
gccggccgtggtgcgcgcctcgatctgcgcgccgtgccgctggaagacagcggcatgtct
gccatggaaatctggagcaacgaaagccaggagcgctatgtgctggccatcgcgcccgaa
tcgctggcgcaactgcgctctttttgcgagcgcgagcgctgcccgttggccgtgctcggc
agcgccaccgaagagcgccaactggtgctgcacgacagcgccgccacggccgccgaccag
caactgccggtaaacctgccgatgggcgtgctgctgggccagccgccccggatgcagcgc
aacgcaagcagcctgcggcgccgctttgtcccgctcgacctgagcggcctgccactgcac
aaggcggtgaccgacgtgctggcccaccccacggtcgcgtccaagcgctttttggtcagc
atcggcgatcgcaccgtgggggggctggtgcaccgcgaccagatggtcggcccctggcag
gtgccggtggccgattgcgcgatcacgctggccgactaccagggctttgccggcgcggcc
atggccattggcgagcgcacgccgctggccgcgctcgatgccccggcctcgggccgcatg
gcggtggccgaggccatcaccaacctgctggccgccccgatcgaactggcgcgcgtcaag
ctcagcgccaactggatggccgcctgcggcgaacccggcgaggacgcggcgctgtacgcc
accgtcgaggccgtgggcctggagctatgcccggcgctgggcctggccatccccgtcggc
aaggacagcctgtcgatgcgcacgcagtggcgcgaaggcgccgggcagacgacggtcagt
tcgcccgtgagcctgatcgtcagcgcctttgccgcgctgaccgacgtgcgcggcagcctg
acgccgcagctcgacgccaccgaagccgagaccacactggtgctgatcgacctgggccgg
ggccgcaaccgcatgggcgccagcatcctgggccagacgctcgagcaaagcggctgcccg
gaaaaagacggggtgcccgatctcgatgcgccgcaagacctgctcgcgctggtcgacgcc
gtcaacgccctgcgcgcccagggccggctgctggcctaccacgaccgcagcgacggcggc
ttgctggcgacggtcgccgagatggcctttgccggccaggtcggcgtggcgctgaacgtg
gatctgctggtgaccgagggcgacggcatcggcgacagccgcatggacaccggcgatgcg
aaaaactgggccgggcaagtgcacgcgcgccgtgaagagcgcacgctcgaggcgctgttc
agcgaagaactcggcgtggtgctgcaagtgcgcacggccgagcgcaacgaggtgatgcag
accctgcgcgcgcatggcctggcgcgctggagccacttcattggcagcacgcgcccggcc
ggcccgcgcgtgttgcaagtctggcgcgatgcgcagcccgtgttcagcgcgccgctggcc
gatttgcagcgggcctgggatacggtgagctggaagatttgccgccagcgcgacaacccg
gacagcgccgatgccgaacatgccgcagccggagaccccaccgaccctggcctgcacctg
cacctgcaaccgacgttcgacgcgccagagcccccggccgcgcccggcctgcgcctggcc
cgtccccgggtcgccatcttgcgcgagcagggcgtgaactcgcatgtcgaaatggcctat
gccttcaccgaggccggctttgccgcctgcgacgtgcacatgaccgacctgcaaaccggc
cgcgtccggctggcagacttcaagggcctggtggcctgcggcgggttcagctacggcgac
acgctgggcgccggcatcggctgggcgcgcagcatcagcttcaacccggcgctggcggcg
cagttccagggcttttttgcgcgcggcgacaccttcggcctgggagtgtgcaacggctgc
cagatgtttgccgaactggccgacatcatccccggcgcgcagtactggccgcgctttacg
accaaccagagccagcgcttcgagtcccgcctgtcgctggtgcaagtgaccgaatcgccc
agcctgttcctgcaaggcatggccggcagccgcctgccggttcccgtcgcgcatggcgag
ggctacgccgacttcaggcagcgcggcgatgccgcgcaagcgatcgcggccctgcgcttc
gtcgacaaccacggcgcggtcaccgagcgctacccgttcaacccgaacggcagccccggc
ggcctgacgggcgtgaccacggccgacggccgcttcacggcgctgatgccgcaccccgag
cgcgtgttccgcaacatccagatgagctggaccccgggcgagcgcagcgcactcagcccc
tggatgcgcctgtggcgcaatgcgcgccggtgggtggggtag

DBGET integrated database retrieval system