KEGG   Verminephrobacter eiseniae: Veis_3853Help
Entry
Veis_3853         CDS       T00460                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00071  Fatty acid degradation
vei00280  Valine, leucine and isoleucine degradation
vei00281  Geraniol degradation
vei00310  Lysine degradation
vei00360  Phenylalanine metabolism
vei00362  Benzoate degradation
vei00380  Tryptophan metabolism
vei00410  beta-Alanine metabolism
vei00627  Aminobenzoate degradation
vei00640  Propanoate metabolism
vei00650  Butanoate metabolism
vei00903  Limonene and pinene degradation
vei00930  Caprolactam degradation
vei01100  Metabolic pathways
vei01110  Biosynthesis of secondary metabolites
vei01120  Microbial metabolism in diverse environments
vei01130  Biosynthesis of antibiotics
vei01212  Fatty acid metabolism
Module
vei_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Veis_3853
   00650 Butanoate metabolism
    Veis_3853
  Lipid metabolism
   00071 Fatty acid degradation
    Veis_3853
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Veis_3853
   00310 Lysine degradation
    Veis_3853
   00360 Phenylalanine metabolism
    Veis_3853
   00380 Tryptophan metabolism
    Veis_3853
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Veis_3853
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Veis_3853
   00281 Geraniol degradation
    Veis_3853
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Veis_3853
   00627 Aminobenzoate degradation
    Veis_3853
   00930 Caprolactam degradation
    Veis_3853
Enzymes [BR:vei01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Veis_3853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABM59562
JGI: Veis3853
UniProt: A1WPK5
Position
complement(4250824..4251594)
Genome map
AA seq 256 aa AA seqDB search
MSEAQSITTQREGGILIITINRPEARNAFDLATSRQMQAVMDMLDADDSLFVGIITGAGG
TFCAGADLKAVARGERPATPERGGFGMFSKPSTKPLIAAVEGYAVGGGLELCLSCDLIVA
ASSAKLGLPEVRNGVVAIGGGLFRLPRRMPHHLAMELALTGDIREAAYFHQQGVVNQLSS
PGCALQDALALAQRLVQNSPLALAASKAVVQAASEQTEAALWDGQMALVAKAFQSEDRQE
GLRAFAEKRKPVWSGR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcgcagagcatcacgacgcagcgcgaaggcggcatcctgatcatcacgatc
aaccgccctgaggcgcggaacgcgttcgatctggccacctcgcgtcagatgcaggccgtc
atggacatgctggatgcggacgacagcctgttcgtcggcatcatcactggcgcgggcggc
accttctgcgctggcgccgacctgaaggcggtggcgcgcggcgagcgtccggccacgccg
gagcgtggcggtttcggcatgttcagcaagccgtccaccaagccgttgatcgcggccgtg
gaaggatatgccgtcggcggcgggctcgagttgtgcctgagctgcgacctcatcgtcgcg
gcatccagtgccaagctgggtctgcccgaggtgcgcaatggcgtcgtcgccatcggcggc
ggcctgttccgcttgccgcggcgcatgccgcaccacctagcgatggaattggcgttgacc
ggggacatccgcgaggcggcttatttccatcagcagggggtagtcaaccagctgtcctct
ccggggtgcgcactgcaggacgccttggcgctggcgcaacgcctggtgcagaactcgccg
ctggccctggcggccagcaaggccgtggtgcaggcagcgagcgagcaaaccgaggcggca
ctgtgggacggccagatggcgctggtcgccaaggccttccagtcggaggatcgccaggaa
ggcctgcgggcctttgctgaaaaacgcaagccggtctggagcggccggtag

DBGET integrated database retrieval system