KEGG   Verminephrobacter eiseniae: Veis_3978Help
Entry
Veis_3978         CDS       T00460                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00020  Citrate cycle (TCA cycle)
vei00310  Lysine degradation
vei01100  Metabolic pathways
vei01110  Biosynthesis of secondary metabolites
vei01120  Microbial metabolism in diverse environments
vei01130  Biosynthesis of antibiotics
vei01200  Carbon metabolism
Module
vei_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vei_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Veis_3978
  Amino acid metabolism
   00310 Lysine degradation
    Veis_3978
Enzymes [BR:vei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Veis_3978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABM59685
JGI: Veis3978
UniProt: A1WPX8
Position
complement(4362744..4364171)
Genome map
AA seq 475 aa AA seqDB search
MNATAHGKRKPSSPWFPKSPKHSERRTGMAIVEVKVPALSESVVEATLLAWKKKPGQAVA
IDEILIEIETDKVVLEVPAPAAGLLAEIVQGDGATVAAEQVIARIDTEGRAAASAASAVS
AAAATVAPAAAQAAKAGVAMPAAAKLLADHQLSAASVPGTGKDGRVTKVDVLGAVARGAA
ATTSFAAATTSFAAATTPFAAAATPSVAATPPASATPAIPTGVPAKVLPQVPAPASSRPQ
WGERPEQRVAMSRLRARVAERLLQSQSTNAILTTFNEVNMAPVMQMRKKFQDAFTKEHGV
KIGFMGFFVKAAVHALKKYPVLNAAVDGNDIVYHGYFDIGIAVGSPRGLVVPILRNADQM
GFADIEKKIAEFAQKAADGKLEIQELTGGTFSISNGGTFGSMLSTPIINPPQSAILGVHA
TKDRAVVEDGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLFDI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccactgcgcacggcaagcgaaaaccctcatccccatggttcccgaagtccccg
aagcattccgaaagaagaactggtatggccatcgtagaagtcaaagtccccgcactgtcc
gaatccgtggtcgaggccaccttgctggcgtggaagaaaaagcccggccaggccgtggca
atcgatgagattctgatcgagatcgaaaccgacaaggtggtgctggaagtgcctgcgccc
gccgccggcctgctggccgagatcgttcagggcgacggcgccacggtcgccgccgagcag
gtcattgcccgcatcgacaccgaaggccgggcggcagcatcggctgcttcggcagtttcg
gccgcagcagccactgtggcgccggccgcagcccaggcagcgaaggccggcgtcgccatg
ccggccgccgccaaactgctggccgaccaccaactgtccgccgcgtcggtgccgggcacg
ggcaaggacggccgcgtgaccaaggtggatgtgctcggtgccgtggcccgcggcgcagcc
gctacgacatccttcgcagccgctacgacatccttcgcagccgctacgacacccttcgcc
gccgctgcgacaccctcggttgctgcaacaccccccgcatccgcgacgcccgccatcccg
accggcgttcccgccaaggtcctgccccaggtgccggcgcccgcatcctccaggccgcag
tggggcgagcgccccgagcagcgcgttgcgatgagccgtctgcgtgcccgcgtggccgag
cgcctgctgcaatcgcagtcgaccaacgccatcctgaccacgttcaacgaagtgaacatg
gcaccggtgatgcagatgcgcaagaagttccaggacgcattcaccaaggagcatggcgtg
aagatcggcttcatgggctttttcgtgaaggcggcagtgcatgccctgaagaaatacccg
gtgctcaacgcggccgtcgatggcaacgacatcgtctaccacggctacttcgacatcggc
atcgccgtcggctcgccccgtggtctggtggtgccgatactgcgcaacgccgaccagatg
ggctttgccgacatcgaaaagaaaatcgccgagttcgcccagaaggccgcggacggcaag
ctggaaattcaggagctgaccggcggcaccttttccatctccaatggcggcacttttggc
tcgatgctgtccacgcccatcatcaacccgccgcagtcggccatcctgggcgtgcacgcc
accaaggaccgcgccgtggtggaggacggccagatcgtcatccgcccgatgaactacctg
gccatgtcttacgaccaccgcatcatcgacggccgcgaagccgtgctgggcctggtggcg
atgaaggaggcgctggaagatcctgcgcgcctgctgttcgacatctga

DBGET integrated database retrieval system