KEGG   Verminephrobacter eiseniae: Veis_3978Help
Entry
Veis_3978         CDS       T00460                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vei  Verminephrobacter eiseniae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Veis_3978
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Veis_3978
  Amino acid metabolism
   00310 Lysine degradation
    Veis_3978
Enzymes [BR:vei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Veis_3978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4362744..4364171)
Genome map
AA seq 475 aa AA seqDB search
MNATAHGKRKPSSPWFPKSPKHSERRTGMAIVEVKVPALSESVVEATLLAWKKKPGQAVA
IDEILIEIETDKVVLEVPAPAAGLLAEIVQGDGATVAAEQVIARIDTEGRAAASAASAVS
AAAATVAPAAAQAAKAGVAMPAAAKLLADHQLSAASVPGTGKDGRVTKVDVLGAVARGAA
ATTSFAAATTSFAAATTPFAAAATPSVAATPPASATPAIPTGVPAKVLPQVPAPASSRPQ
WGERPEQRVAMSRLRARVAERLLQSQSTNAILTTFNEVNMAPVMQMRKKFQDAFTKEHGV
KIGFMGFFVKAAVHALKKYPVLNAAVDGNDIVYHGYFDIGIAVGSPRGLVVPILRNADQM
GFADIEKKIAEFAQKAADGKLEIQELTGGTFSISNGGTFGSMLSTPIINPPQSAILGVHA
TKDRAVVEDGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLFDI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccactgcgcacggcaagcgaaaaccctcatccccatggttcccgaagtccccg
aagcattccgaaagaagaactggtatggccatcgtagaagtcaaagtccccgcactgtcc
gaatccgtggtcgaggccaccttgctggcgtggaagaaaaagcccggccaggccgtggca
atcgatgagattctgatcgagatcgaaaccgacaaggtggtgctggaagtgcctgcgccc
gccgccggcctgctggccgagatcgttcagggcgacggcgccacggtcgccgccgagcag
gtcattgcccgcatcgacaccgaaggccgggcggcagcatcggctgcttcggcagtttcg
gccgcagcagccactgtggcgccggccgcagcccaggcagcgaaggccggcgtcgccatg
ccggccgccgccaaactgctggccgaccaccaactgtccgccgcgtcggtgccgggcacg
ggcaaggacggccgcgtgaccaaggtggatgtgctcggtgccgtggcccgcggcgcagcc
gctacgacatccttcgcagccgctacgacatccttcgcagccgctacgacacccttcgcc
gccgctgcgacaccctcggttgctgcaacaccccccgcatccgcgacgcccgccatcccg
accggcgttcccgccaaggtcctgccccaggtgccggcgcccgcatcctccaggccgcag
tggggcgagcgccccgagcagcgcgttgcgatgagccgtctgcgtgcccgcgtggccgag
cgcctgctgcaatcgcagtcgaccaacgccatcctgaccacgttcaacgaagtgaacatg
gcaccggtgatgcagatgcgcaagaagttccaggacgcattcaccaaggagcatggcgtg
aagatcggcttcatgggctttttcgtgaaggcggcagtgcatgccctgaagaaatacccg
gtgctcaacgcggccgtcgatggcaacgacatcgtctaccacggctacttcgacatcggc
atcgccgtcggctcgccccgtggtctggtggtgccgatactgcgcaacgccgaccagatg
ggctttgccgacatcgaaaagaaaatcgccgagttcgcccagaaggccgcggacggcaag
ctggaaattcaggagctgaccggcggcaccttttccatctccaatggcggcacttttggc
tcgatgctgtccacgcccatcatcaacccgccgcagtcggccatcctgggcgtgcacgcc
accaaggaccgcgccgtggtggaggacggccagatcgtcatccgcccgatgaactacctg
gccatgtcttacgaccaccgcatcatcgacggccgcgaagccgtgctgggcctggtggcg
atgaaggaggcgctggaagatcctgcgcgcctgctgttcgacatctga

DBGET integrated database retrieval system