KEGG   Verminephrobacter eiseniae: Veis_4364Help
Entry
Veis_4364         CDS       T00460                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
vei  Verminephrobacter eiseniae
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Veis_4364
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Veis_4364
Enzymes [BR:vei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Veis_4364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4811556..4812326)
Genome map
AA seq 256 aa AA seqDB search
MLQGKTALVTGSTSGIGLGLAKALARQGANIVLNGFGDIDGARAELLAIGVQVAYHGADM
GRMADIEDLMKYSAAQFGRVDILVNNAGIQHVDDVQDFPPARWDAVIAINLTSAFHTARL
ALPAMRSANWGRIINLASVHGLVGSAGKSAYVAAKHGLVGLTKVIALENATTGVTCNAIC
PGWVLTPLVQQQVDAKAVQHGLSNEQAKQQLLREKEPSMQFTTPEELGELALFLCSPAAN
NVRGVAWNMDGGWAAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctacaaggcaaaaccgccctcgtcaccggctccaccagtggcattggcctgggcctg
gccaaggccctggcgcgccagggcgcgaacatcgtgctcaacggctttggcgacatcgac
ggcgcgcgcgccgaactgctggccatcggcgttcaggtggcctaccacggcgccgacatg
ggccgcatggccgacatcgaagacctgatgaagtacagcgccgcgcagttcgggcgcgtc
gacatcctggtgaacaacgccggcatacagcatgtggacgatgtgcaggattttccgccc
gcgcgctgggatgcggtgatcgccatcaacctcacgagcgcctttcacaccgcccgcctg
gcgctgccggcgatgagaagcgccaactggggccgcatcatcaacctggcatcggtgcat
ggcctggtcggctcggccggcaaatcggcctatgtggccgccaagcatggcctggtgggc
ctgaccaaggtcatcgcgctggagaacgccaccaccggcgtcacctgcaacgccatctgc
cccggctgggtgctgacgccgctggtgcagcagcaggtggacgccaaggccgtgcagcat
ggcctgtcgaacgaacaagccaagcaacagctgctgcgcgagaaagagccctcgatgcag
ttcaccacgcccgaagaactgggcgagttggccctgttcctgtgttcccccgccgccaac
aacgtgcgcggcgtggcctggaacatggacggcggctgggctgcgcagtga

DBGET integrated database retrieval system