KEGG   Verminephrobacter eiseniae: Veis_4458Help
Entry
Veis_4458         CDS       T00460                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00071  Fatty acid degradation
vei00072  Synthesis and degradation of ketone bodies
vei00280  Valine, leucine and isoleucine degradation
vei00310  Lysine degradation
vei00362  Benzoate degradation
vei00380  Tryptophan metabolism
vei00620  Pyruvate metabolism
vei00630  Glyoxylate and dicarboxylate metabolism
vei00640  Propanoate metabolism
vei00650  Butanoate metabolism
vei00900  Terpenoid backbone biosynthesis
vei01100  Metabolic pathways
vei01110  Biosynthesis of secondary metabolites
vei01120  Microbial metabolism in diverse environments
vei01130  Biosynthesis of antibiotics
vei01200  Carbon metabolism
vei01212  Fatty acid metabolism
vei02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Veis_4458
   00630 Glyoxylate and dicarboxylate metabolism
    Veis_4458
   00640 Propanoate metabolism
    Veis_4458
   00650 Butanoate metabolism
    Veis_4458
  Lipid metabolism
   00071 Fatty acid degradation
    Veis_4458
   00072 Synthesis and degradation of ketone bodies
    Veis_4458
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Veis_4458
   00310 Lysine degradation
    Veis_4458
   00380 Tryptophan metabolism
    Veis_4458
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Veis_4458
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Veis_4458
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Veis_4458
Enzymes [BR:vei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Veis_4458
Exosome [BR:vei04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Veis_4458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABM60160
JGI: Veis4458
UniProt: A1WRA3
Position
complement(4926817..4928022)
Genome map
AA seq 401 aa AA seqDB search
MTQAYVFDALRTPRGKGKKDGRLHEVKPIDLLAGLLHALQARQRFDTAAVDDVVMGIVSP
VGEQGSVLPKVAALKAGWDFRCAGVQINRFCASGLEAVNLAAQKVRSGWEDLVVAGGVEC
MSRVPLGSDGGAWAQDPETNLATLFVPQGIGADLIATLDGLRRADVDAFALESQRRASAA
RAAGYFAHSVVPVRDFLGQTILDEDEFIKPQTTLEGLAALKPSFEILGGMGFDAVALQRY
PQVERIAHVHHAGNSSGIVDGAAAVLIGNEAAAKAHGLTPRARIVATALSGADPSIMLTG
PMPATRKVLARAGMTLAQIDLFEVNEAFAAVPMRFMRELGVPHDKLNVNGGAIAMGHPLG
ATGAMLLGTLIDELHRRSQRYGLVTLCVGGGMGIATIVERL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagcctatgtgttcgacgccctgcgcaccccgcgcggcaagggcaagaaggac
ggccgcctgcacgaagtcaaacccatcgatctgctcgcgggtctgttgcacgcgctgcag
gcgcgccagcgcttcgatacggcggcggtcgacgatgtggtcatgggcatcgtctcgccg
gtgggcgaacaagggtccgtgctgcccaaggtggctgcgctcaaggccggctgggatttt
cgctgcgccggcgtgcagatcaaccgcttttgcgcatcgggcctggaagccgtgaatctg
gccgcgcaaaaagtgcgctcgggctgggaagacctggtggtggccggcggcgtggaatgc
atgagccgcgtgccgctaggctcggacggcggcgcctgggcgcaggaccccgagaccaac
ctggccacgctgttcgtgccccagggcatcggcgccgatctgatcgccacgctcgacggc
ttgcgccgcgccgatgtcgatgcctttgcgctcgagtcgcagcgccgcgccagcgccgcg
cgcgcggccgggtatttcgcgcattcggtggtgccggtgcgcgacttcctgggccagacc
atcctggacgaagacgaattcatcaagccccagaccacgctcgaaggtctggccgcgctc
aaaccctcgttcgagatcctgggcggcatgggcttcgacgccgtggcgctgcaacgctac
ccgcaggtcgagcgcatcgcgcatgtgcaccacgcgggcaactcctcgggcatcgtcgat
ggcgcggccgccgtgctgatcggcaacgaggccgccgccaaggcgcatggcctgacgccg
cgcgcgcgcatcgtcgccacggcgctcagcggtgccgaccccagcatcatgctcaccggc
ccgatgccggccacgcgcaaggtgctggcgcgcgccggcatgacgctggcgcagatcgac
ctgttcgaggtcaacgaagcctttgccgccgtgcccatgcgcttcatgcgcgagttgggc
gtgccgcacgacaagctcaacgtgaacggcggcgcgatcgccatgggccacccgctgggc
gccaccggcgcgatgctgctgggcaccctgatcgacgagttgcaccgccgcagccaacgc
tacggcctggtcaccctgtgcgtgggtggcggcatgggcattgccaccatcgtcgaacgc
ctgtga

DBGET integrated database retrieval system