KEGG   Verminephrobacter eiseniae: Veis_4808Help
Entry
Veis_4808         CDS       T00460                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
vei  Verminephrobacter eiseniae
Brite
Enzymes [BR:vei01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Veis_4808
Transfer RNA biogenesis [BR:vei03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Veis_4808
 Prokaryotic Type
    Veis_4808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5308804..5309214
Genome map
AA seq 136 aa AA seqDB search
MLKAVATRVRRGFWSVAGVSLFVLSLAAVQARQSPSTDGIASSITLAELPPQGRETYAQI
RTGGPFAHAKDGTVFGNRERLLPANQRGYYREYTVRTPGLRDRGARRIVCGGSRPRIPDA
CYYTSDHYASFREIVE
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaggctgtagccacccgggtgcgcaggggtttttggagtgttgcgggtgtttcg
ttgttcgtgctgtctttggcggcggtgcaggcccgccaatccccgtccaccgacgggatc
gccagttccatcacattggccgagttgccgccccaggggcgcgagacttatgcgcagatt
cgcacgggagggcctttcgcgcatgccaaggacgggacggtctttggcaatcgcgagcgg
ctgctgcccgccaaccagcggggctactaccgtgaatacaccgtcagaacaccaggactg
cgcgaccggggagcccggcgcatcgtctgtggcggcagcaggccccggataccggatgcc
tgctactacaccagtgaccactacgccagttttcgcgagattgtcgagtaa

DBGET integrated database retrieval system