KEGG   Verminephrobacter eiseniae: Veis_4847Help
Entry
Veis_4847         CDS       T00460                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
vei  Verminephrobacter eiseniae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Veis_4847
Enzymes [BR:vei01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Veis_4847
Peptidases [BR:vei01002]
 Cysteine Peptidases
  Family C44
   Veis_4847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5359631..5361385
Genome map
AA seq 584 aa AA seqDB search
MCGIAGVVNATGVTKDDVWAMVGSIRYRGVDAQAVEDLGGAIVGNVLLKIAALENGRQPM
SSTDGKVWVVFNGEIFNFIELREQLQAKGYRFKSRCDTEVLVHLWCEKGEQMLDDLVGMF
AFFIWDQRTQTGMLARDRQGIKPCFYAPYRGGLAFASEIKAILALPKFERKVNESALGDV
FSFNYCPPPQTCFEGIHHLPPGCFMRYGSGRFSEPVRYWRWPLDGERVDASQADLENALG
EAVKLQMRFEVDGGLFLSGGVDSSVIAHHLLPQWKQPRLDAIGLRIEEQGFSEYAYAERV
ATDLNINLSALDIRPADIADIARSVVRHAEQPHGDFSFFLFYLLSRRAHQMGKVVMFTGD
GPDEVMLGYRHNAQFFSGMTRARFSMRDYFDLISYSTRQERQRVMSPSFLPHTEGAFDRF
MGIIEPFGGLEPMEQVAAYELTSLMPGNDSPKSDRMGACWSIEGRAPFLDHRVSELFARL
PIQSKFHQGVGKHFLKRVAQSYYDHDFVFRPKTMPTLPIGEWIKGPLYPWARDILALPDG
GRFDASGLQHMLQEHRSGMHNHTKPLRTLLMTKLWLQEFFSEGA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggatagccggtgtggtcaacgcgacgggggtgacgaaagacgatgtctgggcg
atggtcgggagcatcagataccgcggcgtcgatgcacaagctgtcgaagacctgggcggt
gccattgtcggcaatgtcctgctgaagatagccgctctcgaaaacggcaggcaaccgatg
tcgagcaccgacggcaaggtctgggttgtcttcaacggcgagatcttcaatttcatcgag
ttgcgcgagcagctacaggccaagggctaccggttcaaatcgcgctgcgataccgaggtg
ctggtgcatctgtggtgcgaaaagggcgaacagatgctcgacgatctggtcggcatgttc
gcctttttcatctgggaccagcgcacgcagaccggcatgctggcccgcgaccgccagggc
atcaagccctgcttttatgcgccgtatcgcggcggcctggcgtttgccagcgagatcaaa
gccatcctggcgctgccaaagttcgagcgcaaagtcaacgaatcggcgttgggcgatgtg
ttcagcttcaactactgcccaccgccgcagacctgcttcgaaggcatccatcatctgccg
ccgggctgtttcatgcgttacggatcgggccgattttccgagcctgtgcgctactggcgc
tggccgctcgatggcgagcgcgtcgacgcctcgcaggccgatctggaaaatgcgctcggc
gaagccgtcaagctgcaaatgcgttttgaggtcgatggggggctgtttctttcggggggc
gtcgactcttcggtcatcgcccatcacttgctgccccagtggaagcagccccggttggac
gccatcggtctgcgcatcgaagagcaaggtttttccgaatacgcttacgccgagcgtgtg
gccaccgacctgaacatcaacctgagcgcactggatatccgaccggccgatattgcggac
attgcacgctcggtcgtgcggcatgccgagcagccgcatggcgacttttcgtttttcctg
ttctacctgctgtcgcgccgggcgcaccagatgggcaaggtcgtcatgttcacgggcgac
ggcccggacgaggtcatgctgggctatcgccacaacgcgcaatttttctccgggatgacg
cgcgcccggttttcgatgcgcgactacttcgacctcatcagctacagcacccggcaagag
cgccagcgggtgatgagcccgtcttttctgccccacaccgaaggcgcgttcgacaggttc
atgggcatcatcgaaccctttggcggcttggagccgatggaacaggtcgccgcctacgag
ttgacctcgctgatgcctggcaacgactcccccaagagcgatcgcatgggcgcctgctgg
tcgatcgaagggcgcgcgcccttcctggaccacagagtcagcgaattgttcgcgcgtttg
ccgatccagtccaagttccaccaaggggtgggcaagcatttcctcaagcgggtggcgcag
agctattacgaccacgacttcgtgttccggcccaagaccatgcccacgctaccgatcggc
gagtggatcaaagggccgctttacccatgggcgcgcgacatcctggcgctacccgatggc
ggccgcttcgatgccagcgggctgcaacacatgttgcaagagcaccgcagcggcatgcac
aaccacaccaagcccctgcgcacgctgctgatgaccaaactgtggctgcaagagtttttc
tccgagggcgcttga

DBGET integrated database retrieval system