KEGG   Verminephrobacter eiseniae: Veis_4868Help
Entry
Veis_4868         CDS       T00460                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vei  Verminephrobacter eiseniae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Veis_4868
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Veis_4868
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Veis_4868
Enzymes [BR:vei01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Veis_4868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(5381578..5382843)
Genome map
AA seq 421 aa AA seqDB search
MTSYRQPDAAGHFGPYGGSFVSETLTLAIAQLRTAYARYQNDPEFLAEFGDELKHFVGRP
APIYHAARSSREIGGAQIYLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAETGAGQH
GVAAATICARYGLECVVYMGAHDVRRQSPNVYRMKLLGATVVPVESGSRTLKDALNEAMR
DWVTHVDDTFYIIGSVAGPHPYPMMVRDFQSIIGKECIEQMPAMLARNMAAGQQPDAVIA
CVGGGSNAMGIFHPYIPFAGTRLIGVEAAGLGLESGQHSASLQKGSPGVLHGSRTFVLQD
ANGQITETHSISAGLDYPGVGPEHAWLQQIGRAEYVGITDQEALDAFHFLCRTEGIIPAL
ESSHAVAHALKLAKTMRPDQSILVNLSGRGDKDIGTVADLSGADFYCRPSCHGQSVKGAS
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctatcgacagcctgatgccgccggccacttcggcccctacggcggcagtttc
gtcagcgagacgctgaccctggccatagcgcaattgcgcacggcctacgcccgctaccag
aacgacccggagttcctggccgagttcggcgacgagctcaagcatttcgtgggccgcccc
gcgccgatctaccacgccgcccgcagcagccgcgagatcggcggcgcgcagatctacctc
aagcgcgaagacctcaaccacaccggcgcccacaagatcaacaacgtgatcggccaggcc
atgctcgccaggcgcatgggcaaaccccgggtgattgccgaaaccggcgccggccagcat
ggcgtggccgcagccaccatctgtgcgcgctatgggctcgaatgcgtggtctacatgggc
gcgcacgatgtgcggcgccaaagccccaatgtctaccgcatgaaactgctgggcgccacc
gtggtgccggtggagtccggcagccggaccctgaaggacgccctcaacgaagccatgcgc
gactgggtgacccatgtggacgacaccttctacatcatcggctcggtggccgggccgcac
ccctatccgatgatggtgcgcgactttcagagcatcatcggcaaggaatgcatcgagcag
atgccggccatgctggcccgcaacatggcggccggccagcagcccgacgccgtgatcgcc
tgcgtgggcggcggcagcaacgcgatggggatcttccacccctacatcccgtttgccggc
acgcgcctgatcggcgtcgaagccgccggcctggggctggagtcgggccagcattcggca
tcgctgcaaaagggcagcccgggcgtgctgcacggcagtcgcactttcgtcctgcaagat
gccaacggccagatcaccgaaacccacagcatcagcgcgggcctggactaccctggcgta
ggccccgagcatgcctggctgcagcagatcggccgcgccgagtatgtcggcatcaccgac
caggaggcgctcgatgccttccacttcctgtgccgtaccgagggcatcatcccggccctc
gaatccagccatgccgtggcccatgcgctcaaattggccaagaccatgcgcccggaccag
tcgatcctggtcaacctctcgggccgtggcgacaaggacataggcaccgtggccgacctg
agcggtgccgatttctactgccgccccagttgccatgggcagtccgtcaagggggccagc
caatga

DBGET integrated database retrieval system