KEGG   Vibrio sp. EJY3: VEJY3_00140Help
Entry
VEJY3_00140       CDS       T01683                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vej  Vibrio sp. EJY3
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEJY3_00140 (fadB)
   01212 Fatty acid metabolism
    VEJY3_00140 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VEJY3_00140 (fadB)
   00650 Butanoate metabolism
    VEJY3_00140 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    VEJY3_00140 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    VEJY3_00140 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VEJY3_00140 (fadB)
   00310 Lysine degradation
    VEJY3_00140 (fadB)
   00380 Tryptophan metabolism
    VEJY3_00140 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VEJY3_00140 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VEJY3_00140 (fadB)
   00281 Geraniol degradation
    VEJY3_00140 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    VEJY3_00140 (fadB)
Enzymes [BR:vej01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VEJY3_00140 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VEJY3_00140 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VEJY3_00140 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     VEJY3_00140 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(28795..30966)
Genome map
AA seq 723 aa AA seqDB search
MIYQAETLQVKEIQDGIAELSFCSPKSVNKLDLATLESLDKALDALIAHQGLKGVMLTSD
KDAFIVGADITEFLGLFAKTDEELDQWLQFANSIFNKLEDLPVPTISVIKGHALGGGCEC
VLATDMRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADNAMEIITQGKALRADEALK
LGLLDAVVDSDSLHASALQTLTSAINEKLDWQARRKQKTSPLTLSKLESMMSFTMAKGLV
AQKAGPHYPAPITSVLTIEEGARFARNEALDVERKHFVKLAKSEEAKSLVGLFLSDQYIK
GIAKKAAKSANKDTKRAAVLGAGIMGGGIAYQSALKGVPVLMKDIAQASLDLGMNEASKL
LNKRLATGRLDGFKMAGILASITPSLHYAGIENSDVIVEAVVENPKVKAAVLSEVEQNVG
EDTVITSNTSTIPINVLAQSLQRPENFCGMHFFNPVHRMPLVEIIRGEKTSDETINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTQIDKIMERKFGWPMGPAY
LLDVVGIDTAHHAQAVMAEGFPERMGKQGRDAIDTLFEANKFGQKNGSGFYSYSVDKKGK
PKKTFSEEILPLLADVCADKRDFDEQTIIQRMMIPMINEVVLCLQEGIIATPQEADMALV
YGLGFPPFRGGVFRYLDSVGIAEYIETAKQHAELGAMYQVPQMLIDMAAKGETFYGAQQQ
GSI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccgaaaccctacaggtaaaggaaatacaggatggcattgcagagctg
agtttctgctcgccaaaatccgtaaataaactcgatttagcgacactagagtcactagac
aaagcccttgatgcacttatcgcacaccaaggtctgaaaggcgtaatgctgacttcagat
aaagatgcgttcattgtaggtgcagacattactgaattcttaggcctgtttgctaagact
gatgaagaactggatcagtggctacaattcgccaacagcatcttcaacaaacttgaagac
cttccagtcccaaccatctcagtcatcaagggccacgctcttggtggtggctgcgagtgt
gtattggcaacagacatgcgcatcggtgacaaaaccaccagcatcggtctaccagaaacg
aaacttggcatcatgccaggctttggtggttgtgtacgtctacctcgtgttatcggtgct
gataacgcgatggaaatcattacacaaggtaaagcgctccgtgctgatgaagcactaaaa
cttggcctgttagatgcggttgtcgattcagactctctgcatgcatccgctctgcaaaca
ctgacgtctgcaatcaacgaaaaacttgattggcaagctcgccgcaaacaaaaaacatca
ccactaacgctaagcaagctagagtcgatgatgagcttcaccatggcaaaaggcctggtg
gcgcaaaaagcgggcccacactacccggcaccaatcacatcagtccttactattgaagaa
ggcgctcgatttgcacgtaatgaagcgctggatgttgaacgtaagcacttcgttaaactg
gcaaaatcagaagaagcgaaatcactggttggtctgttccttagcgatcagtacattaaa
ggcatcgctaaaaaagcggcaaaatcagcaaacaaagacactaaacgtgctgctgtactt
ggcgcaggtatcatgggtggcggtatcgcttaccaatctgcactgaaaggtgtgcctgta
ctgatgaaagacatcgctcaggcatctctagatttgggcatgaacgaagcgtcgaaactg
ctgaataagcgtcttgctacgggtcgtcttgacggcttcaagatggcgggcatcctcgcg
tctattactccaagcttgcactacgctggcatcgaaaactcagatgtgattgtcgaagcc
gtggttgagaatccgaaagtaaaagctgcggtacttagcgaagtcgagcaaaacgtgggc
gaagatacggttattacgtctaacacatcgaccattccaatcaacgttctggctcagtca
ctacaacgcccagaaaacttctgtggtatgcatttctttaaccctgtgcatcgcatgcca
ttggttgagatcatccgcggtgaaaaaacgtcagatgaaaccatcaaccgtgttgtggct
tacgcagcgaaaatgggtaaatcaccaatcgtcgttaatgactgccctggtttcttcgta
aaccgcgtactgttcccgtactttggtggtttcagcatgctgcttcgtgacggcgctgac
ttcactcaaatcgacaaaatcatggaacgcaagtttggttggccaatgggtccagcatac
ttgcttgacgttgtaggtatcgataccgctcaccacgcacaagccgtcatggctgaaggc
ttcccagagcgtatgggcaagcaaggtcgcgatgcgattgatactttgtttgaagccaac
aagtttggccagaaaaatggcagcggtttctacagctattcagttgataagaaaggtaaa
ccgaagaagaccttctctgaagaaatcttgccactgttagctgacgtatgtgcagataaa
cgtgacttcgacgagcaaaccatcatccaacgaatgatgattcctatgatcaacgaagtg
gtgctgtgtctacaggaaggcattatcgcgacaccacaagaagcggacatggctctggtt
tacggtctgggcttccctccattccgcggcggtgtattccgctacctagacagcgttggt
attgctgagtacatcgaaacagcaaaacaacacgctgaactaggcgcgatgtaccaagta
ccgcaaatgctgattgatatggcagccaaaggagagaccttctacggcgcacaacagcaa
ggctctatctaa

DBGET integrated database retrieval system