KEGG   Vibrio sp. EJY3: VEJY3_00475Help
Entry
VEJY3_00475       CDS       T01683                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vej  Vibrio sp. EJY3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VEJY3_00475
Enzymes [BR:vej01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     VEJY3_00475
Exosome [BR:vej04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VEJY3_00475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:111166..112230
Genome map
AA seq 354 aa AA seqDB search
MVSVSIQGPFPARRMRRLRKHDFSRRLVAENQLSVNDLIYPMFILMGKDRRESVESMPGV
ERLSIDLMLEEAQYLANLGVPAIALFPVVNQDAKSLCATEAYNPEGLVQRAVRSLKEHIP
QIGVITDVALDPFTTHGQDGIIDEDGYVMNDETTEVLVKQALSHAEAGADIVAPSDMMDG
RIGKIREALEEAGHIHTQIMAYSAKYASNYYGPFRDAVGSSSNLKGGNKKNYQMDPANID
EAIHEVALDINEGADSVMVKPGMPYLDVVRRVKTELQVPTFAYQVSGEYSMHKAAILNGW
LKERETVMESLLCFKRAGADGILTYFAKDVAEWLAEENAQAAQYLNMSQKATEE
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctgtatcaattcaaggtccattccctgcacgccgtatgcgtcgcttacgtaag
catgactttagccgtcgtctagtggctgagaaccaactttctgttaatgatttgatttac
ccaatgttcattctgatgggcaaagatcgtcgtgaaagcgtagagtccatgccgggtgta
gagcgtttgtctattgatttaatgctagaagaagcgcaataccttgcaaatctaggtgta
cctgcaatcgcacttttccctgtcgtaaaccaggatgcgaaaagcttatgtgcgactgaa
gcctataacccagaaggtttagttcagcgtgcagtgcgttctctgaaagagcatatccct
caaatcggtgttattaccgacgttgcgctggatccatttaccacgcatggccaagacggc
atcattgatgaagacggctatgtaatgaatgatgaaacgactgaagtgttggttaaacag
gcgttgtctcacgcagaagcgggtgctgatattgttgcaccatcagacatgatggatgga
cgtattggtaaaatccgtgaagcgctagaagaagcaggccatattcatactcaaatcatg
gcttactctgcgaaatacgcttcgaactactacgggccattccgtgatgcggtcggttct
tcgtctaaccttaaaggtggcaataagaaaaactaccaaatggatccggcaaatattgat
gaggcgattcacgaagtcgcgctggatatcaatgaaggtgccgattctgtaatggttaag
ccgggaatgccttatctggatgtggtacgccgtgtgaagactgagttgcaggttccgaca
tttgcttaccaagtgtcgggtgagtattcgatgcataaagcagcgattctaaacggttgg
ttaaaagagcgtgaaacggtgatggaatcattgctatgtttcaaacgtgcgggcgctgat
ggcatcctgacttactttgccaaagatgtggcggagtggttagcggaagaaaacgcacaa
gcggctcaatatctaaatatgtctcagaaagcgacagaagagtaa

DBGET integrated database retrieval system