KEGG   Vibrio sp. EJY3: VEJY3_00520Help
Entry
VEJY3_00520       CDS       T01683                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  
oxygen-independent coproporphyrinogen III oxidase [EC:1.3.99.22]
Organism
vej  Vibrio sp. EJY3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VEJY3_00520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:121108..122499
Genome map
AA seq 463 aa AA seqDB search
MSNQHTESKQQIVWDQAVLDKYNYSGPRYTSYPTALEFHEAFTISDYDMACAQYPDRPLS
LYIHIPFCHKLCYYCGCNKVITRHSHKADEYLDVLEHEIRQRASLLVGRTVTQLHFGGGT
PTFLSEKQITRVMNLLRQEFFFSDDAEISIEVDPREIELTMLDHLRSEGFNRLSIGVQDF
NKEVQKLVNREQDETFIFDMVARAKDLGFRSTNLDLIYGLPKQTKESFAKTLEQVLEMSP
GRLSVFNYAHMPQLFAAQRKIKDEDLPQAEEKMAILQDTIATLTDAGYQFIGMDHFAKPD
DELAVAQREGVLHRNFQGYTTQGECDLVGFGVSAISMIGDAYAQNQKELKKYYAQVNDLR
HALWKGVSLDADDLLRREVIKQLICNFKLDKRAIESEFKVKFNQYFKEDLELLQTFINDE
LVEVDDNEIRVTLRGRLLIRNICMSFDKYLRAKARQQQFSRVI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcaacacactgaatcgaaacaacaaatcgtttgggatcaagcagtattggat
aagtacaactattccggtcctcgctatacgtcgtacccgacagcattggagtttcacgaa
gcatttactatttctgattatgatatggcatgtgctcagtaccctgatcggccgttatcg
ttatacatccatattccgttctgtcacaagctttgttactactgtggttgtaataaggtg
attactcgtcactcgcataaagccgatgagtacctcgatgttctagagcacgaaattcgt
caacgtgcctctttgctagtgggcagaacagtaacgcaattgcattttggtggtggtaca
ccaacgttcctatctgaaaaacagatcacacgtgtgatgaacctgcttcgccaggaattt
ttcttcagtgatgatgccgaaatcagcattgaagttgatccgcgagaaattgaactcact
atgctggatcacctgcgcagcgaaggctttaatcgcttaagtatcggcgttcaggacttt
aacaaagaagttcagaaactggtcaatcgtgagcaggatgaaacgttcatttttgatatg
gtggcacgtgcgaaagacttgggcttccgctcgacaaacctggatttaatctacggctta
ccgaagcagaccaaagagtcttttgctaagacattggagcaagtgcttgaaatgtcgccg
ggtcgtctgtcggtatttaactacgcccacatgccgcagctgtttgccgctcagcgtaag
attaaagatgaagacctgcctcaagccgaagaaaagatggcgattttgcaagataccatc
gcaacgttaaccgatgcgggttaccagtttatcggtatggatcactttgctaagcctgat
gatgaacttgcggttgctcagcgagaaggtgtgctgcatcgcaacttccagggttatacc
acacaaggtgagtgtgacttagtcggctttggcgtttcggctatctcgatgattggtgac
gcttatgcgcagaaccaaaaagagttgaagaaatactacgctcaggtgaatgacctgcgt
catgcgctttggaaaggcgtctcgctggatgcggatgacttactacgccgcgaagtaatt
aagcaactgatctgtaactttaaactggataaaagagccattgagtcggagtttaaggtt
aagtttaatcagtacttcaaagaagacttggagctgttacaaaccttcattaatgatgag
ctggtcgaagtggatgacaacgaaattcgtgtcactctacgcggtcgcctgcttatccgt
aacatctgtatgagtttcgataagtacctccgtgcgaaggctcgtcagcagcagttctct
cgagtgatttag

DBGET integrated database retrieval system