KEGG   Vibrio sp. EJY3: VEJY3_00750Help
Entry
VEJY3_00750       CDS       T01683                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00230  Purine metabolism
vej01100  Metabolic pathways
Module
vej_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VEJY3_00750 (gmk)
Enzymes [BR:vej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     VEJY3_00750 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 MMR_HSR1 RsgA_GTPase ABC_tran AAA_22 AAA_29 cobW
Motif
Other DBs
NCBI-ProteinID: AEX20649
UniProt: H2IBU4
Position
1:complement(174081..174704)
Genome map
AA seq 207 aa AA seqDB search
MGKGTLYIVSAPSGAGKSSLISAMLERNPTYAMKVSVSHTTRDMRPGEENGIHYHFVAKE
EFEALIAKGDFLEYAEVFGNYYGTSRVWIEETLNKGIDVFLDIDWQGARQIREQMPEAKS
IFILPPSNGELERRLNTRGQDSDEVIAKRMAEAKSEISHYNEYDYVIVNDDFDTALMDFK
AILRAERLKEEKQAAKYKGMLDALLAE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaggtactctctatatcgtatctgcacctagcggcgcaggtaaatctagcttg
atctcagcaatgttggagcgcaatccgacatacgcaatgaaagtgtctgtgtctcacacc
actcgcgacatgcgccctggtgaagaaaacggtatccactaccacttcgtagcaaaagaa
gagtttgaagctcttattgcgaaaggtgactttttggaatacgccgaagtattcggtaac
tactatggcacttcccgcgtctggattgaagaaacgctaaacaaaggtatcgacgtattt
ttggatatcgactggcaaggtgcacgacaaattcgtgagcaaatgcctgaagcaaaaagc
atcttcattcttcctccatcaaatggtgagctagaacgtcgcctgaacactcgcggccaa
gacagcgatgaagtcattgccaagcgcatggcagaagccaagtcagaaatctcgcattac
aacgagtacgattacgtgattgtaaacgacgatttcgatacagcgctgatggactttaaa
gctattcttcgagctgaaagattgaaggaagaaaaacaagctgctaaatataaaggtatg
cttgacgcgttgttagcagagtaa

DBGET integrated database retrieval system