KEGG   Vibrio sp. EJY3: VEJY3_00885Help
Entry
VEJY3_00885       CDS       T01683                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
vej  Vibrio sp. EJY3
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:vej03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:202392..203201
Genome map
AA seq 269 aa AA seqDB search
MPELPEVEVSRMGITPHMLDQTIQAFVFRTPKLRWDIPQELKQLEGQVIRAIRRRAKYLL
IETDKGTAIVHLGMSGSLRVLDADFPPAKHDHVDLKLTNGKVLRYNDPRRFGAWLWCAPG
ESHTVLDHMGPEPLTDEFNAEYVAEKAQGKRVAVKQFIMDNKVVVGVGNIYANESLFKSR
IHPTRPTGQVTAEEWKLLVTNIKATLEIAINQGGTTLKDFAQADGKPGYFAQELLVYGKA
GEPCPECGEPLQEQKIGQRNTFFCEECQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacctgaagtcgaagtcagccgtatgggaatcacgccgcatatgcttgat
caaacgatccaggcgtttgtgtttcgtacccccaaactacgctgggatatcccccaggaa
ctgaaacagcttgaagggcaagtgattcgtgcaatccggcgccgtgctaagtacctgttg
attgagacggataagggaaccgcgattgttcatctgggtatgtcaggctcgctacgtgtg
cttgatgccgattttccaccggctaaacatgatcatgtggatctgaagctgactaatggc
aaagtactgcgctacaacgacccgcgtcgatttggagcgtggttatggtgcgcgccgggt
gagtctcacaccgtacttgatcatatggggccagagccgttgactgacgaattcaatgct
gagtatgtggcagaaaaagcgcaaggcaagcgtgttgctgtaaagcagttcattatggac
aacaaagtcgtggtcggcgttggtaatatctacgcgaatgaatccctgtttaaatctcgg
atccatccaaccagacctacgggtcaagtgacggcagaagagtggaagttactggttacc
aacattaaagctactcttgaaatcgcaatcaaccaaggcggtaccactctcaaggatttt
gcacaggcagacggtaaacctggatactttgcccaggaactattggtttatggaaaagca
ggagagccttgccctgaatgcggtgagccacttcaagagcaaaagattggtcagcgtaat
actttcttttgtgaggaatgccagaagtaa

DBGET integrated database retrieval system