KEGG   Vibrio sp. EJY3: VEJY3_01010Help
Entry
VEJY3_01010       CDS       T01683                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
vej  Vibrio sp. EJY3
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    VEJY3_01010
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    VEJY3_01010
Enzymes [BR:vej01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     VEJY3_01010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:229981..230526
Genome map
AA seq 181 aa AA seqDB search
MKVIDTKIPDVKIIEPTVFGDERGFFMETWNQKQFEELVTGKPTQFVQDNHSKSKKGILR
GLHYQTVNTQGKLVRVVSGEVFDVAVDIRRDSPTFGQWVGVYLSAENKRQLWVPEGFAHG
FYVTSDEAEFVYKCTDFYNPSAEVSIIWNDEDVGIIWPVEGEVYLSEKDKEGVSLKCAEA
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttatcgataccaaaattccagatgttaaaattattgaaccaacggtatttggt
gatgagcgtggtttctttatggagacctggaaccaaaagcaatttgaagagttagtaact
ggaaaaccaacacagtttgtacaagataaccactcaaagtcaaaaaaaggcattttacgt
ggtttgcattatcaaacggtgaacacgcaaggtaaattagtgcgagtggtttctggcgag
gtttttgacgttgcggttgacattcgtagagactctccaacatttggtcaatgggtaggt
gtgtacttatcagctgaaaataaacgtcagttatgggtaccggaaggttttgctcatggc
ttttatgtgactagtgatgaggcggagtttgtgtacaaatgtaccgacttttataatcct
agtgcagaagtttctattatttggaatgatgaagatgtaggtataatttggccagtagaa
ggagaagtatatctatcagagaaagataaagaaggggttagtttaaagtgtgctgaggcg
ctttaa

DBGET integrated database retrieval system