KEGG   Vibrio sp. EJY3: VEJY3_01195Help
Entry
VEJY3_01195       CDS       T01683                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vej  Vibrio sp. EJY3
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEJY3_01195 (tpiA)
   01230 Biosynthesis of amino acids
    VEJY3_01195 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VEJY3_01195 (tpiA)
   00051 Fructose and mannose metabolism
    VEJY3_01195 (tpiA)
   00562 Inositol phosphate metabolism
    VEJY3_01195 (tpiA)
Enzymes [BR:vej01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VEJY3_01195 (tpiA)
Exosome [BR:vej04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VEJY3_01195 (tpiA)
  Exosomal proteins of bladder cancer cells
   VEJY3_01195 (tpiA)
  Exosomal proteins of melanoma cells
   VEJY3_01195 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(274624..275394)
Genome map
AA seq 256 aa AA seqDB search
MRRPVVMGNWKLNGSKAMVTELLTGLNAELEGVEGVDVAVAPPALYIDLAERVIAEGGNK
IILGAQNTDLNNSGAFTGDMSPEMLKDFGATHIIIGHSERRDYHNESDEFIAKKFNFLKE
NGLTPVFCIGESEAQNEAGETEAVCARQINAVIDAYGVEALNGAIIAYEPIWAIGTGKAA
TAEDAQRIHASIRALIAAKDEAVAEQVIIQYGGSVKPENAEAYFSQPDIDGALVGGASLD
AKSFAAIAKAAAAAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtcctgtagttatgggtaactggaaactaaacggcagcaaagcaatggtaact
gagctgctaactggtcttaacgctgagcttgaaggcgttgaaggtgttgacgtagcagta
gctccaccagcactttacatcgatctagctgagcgcgtaatcgcagaaggcggtaacaag
atcattctaggtgcgcaaaacactgacctaaacaacagcggtgctttcactggcgacatg
tctccagaaatgttgaaagatttcggtgctacacacatcatcatcggccactctgagcgt
cgtgattaccacaacgaatcagacgagttcatcgcgaagaaatttaacttcctaaaagaa
aacggcctaacgccagttttctgtatcggtgaatctgaagcacaaaacgaagcaggcgaa
actgaagcagtatgtgctcgtcaaatcaacgcagttatcgacgcttacggcgttgaagct
ctaaacggcgcaatcattgcttacgaaccaatctgggcaatcggtactggtaaagcagca
acagctgaagatgcacaacgcatccacgcttctatccgtgcactaatcgcagcgaaagac
gaagcagttgctgagcaagtaatcatccaatacggcggttctgttaaaccagaaaacgca
gaagcatacttctcacaaccagacatcgatggtgctctagttggtggtgcttctctagac
gcgaagagcttcgcagcaatcgctaaagcagcggcagcagcaaaagcttaa

DBGET integrated database retrieval system