KEGG   Vibrio sp. EJY3: VEJY3_01630Help
Entry
VEJY3_01630       CDS       T01683                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vej  Vibrio sp. EJY3
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VEJY3_01630
   00670 One carbon pool by folate
    VEJY3_01630
Enzymes [BR:vej01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     VEJY3_01630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:349648..350127
Genome map
AA seq 159 aa AA seqDB search
MIISMIAAMADNRIIGKDNQMPWHLPADFVWFKRCTMGKPVVMGRKTYESIGRPLPGRLN
IVISRDESLSIEGVTTVTSIDQALEVAGDVEEVMIIGGGAIYSACLPLATKLYVTHIEAA
IEGDTQFPDWGNEFKETYSEAYQADEKNAYNMRFTILEK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcattagtatgattgccgcgatggcagacaatcgtatcattggtaaagataatcaa
atgccatggcacttgccggctgacttcgtatggtttaagcgttgcaccatgggtaagccc
gtcgtcatgggacgcaaaacgtatgagtctatcggacgtccgttgcctggtcgtcttaat
atcgttatcagtcgtgatgaatctctaagtatcgaaggggtgacgacagtgacgtccatt
gatcaagcattagaggttgcgggtgatgtggaagaagtgatgatcattggtggtggagct
atttactcagcctgtctaccactcgcaacgaagttgtatgtgacacatattgaggcagct
atcgaaggtgatacgcagttccctgattgggggaatgagtttaaagaaacttattctgaa
gcgtatcaagcggatgagaaaaacgcctacaacatgcgctttacgattctggaaaaataa

DBGET integrated database retrieval system