KEGG   Vibrio sp. EJY3: VEJY3_01630Help
Entry
VEJY3_01630       CDS       T01683                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vej  Vibrio sp. EJY3
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vej00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:vej00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:349648..350127
Genome map
AA seq 159 aa AA seqDB search
MIISMIAAMADNRIIGKDNQMPWHLPADFVWFKRCTMGKPVVMGRKTYESIGRPLPGRLN
IVISRDESLSIEGVTTVTSIDQALEVAGDVEEVMIIGGGAIYSACLPLATKLYVTHIEAA
IEGDTQFPDWGNEFKETYSEAYQADEKNAYNMRFTILEK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcattagtatgattgccgcgatggcagacaatcgtatcattggtaaagataatcaa
atgccatggcacttgccggctgacttcgtatggtttaagcgttgcaccatgggtaagccc
gtcgtcatgggacgcaaaacgtatgagtctatcggacgtccgttgcctggtcgtcttaat
atcgttatcagtcgtgatgaatctctaagtatcgaaggggtgacgacagtgacgtccatt
gatcaagcattagaggttgcgggtgatgtggaagaagtgatgatcattggtggtggagct
atttactcagcctgtctaccactcgcaacgaagttgtatgtgacacatattgaggcagct
atcgaaggtgatacgcagttccctgattgggggaatgagtttaaagaaacttattctgaa
gcgtatcaagcggatgagaaaaacgcctacaacatgcgctttacgattctggaaaaataa

DBGET integrated database retrieval system