KEGG   Vibrio sp. EJY3: VEJY3_01855Help
Entry
VEJY3_01855       CDS       T01683                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vej  Vibrio sp. EJY3
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VEJY3_01855
Enzymes [BR:vej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     VEJY3_01855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:404632..405114
Genome map
AA seq 160 aa AA seqDB search
MITAYIGVGTNIDREQHAKVAYNELQQLGEDLLVSPIYECEPIGFSSQNFYNFVITLRTA
LSLEEFSHRLREIEFKWGREENAQKYQDRTLDLDIVLFGEIISTQKPELPRSDIYKYPFV
TKPLYDLNPHLVIPGDGRTVADIWYAMQPVDSLKPVSFSL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgcttatatcggtgtaggtacgaacatagacagagagcaacacgcaaaggtt
gcttacaacgagctgcaacagcttggagaagatcttcttgtatccccgatatatgaatgt
gagccaattggtttcagcagccagaatttctacaactttgtgattactcttcgcactgca
ttgtcattagaagagtttagtcatcgccttcgtgagattgaatttaagtgggggcgagaa
gaaaatgcgcaaaagtatcaggatcgaacactcgatctcgatatagtgttgttcggtgag
attatctctacacaaaagcccgaactgcctcgcagtgatatctacaaatatccttttgtc
acaaagcctttgtatgatctcaacccacatttggttattcctggtgatggacgcacggtc
gcggatatatggtacgcgatgcaaccagttgattctctcaaaccagtttctttttcactt
taa

DBGET integrated database retrieval system