KEGG   Vibrio sp. EJY3: VEJY3_02305Help
Entry
VEJY3_02305       CDS       T01683                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vej  Vibrio sp. EJY3
Brite
Enzymes [BR:vej01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VEJY3_02305
Secretion system [BR:vej02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VEJY3_02305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:514590..515378
Genome map
AA seq 262 aa AA seqDB search
MSVLRRLTLLTLPFFVTACGAEESQAKTETPAQQVAPTAQQHFDEAALKAKFSKLGLSIV
DIKPSDVTGLLEIQTNGGILFASNDGNHFIAGTLYAIDENGGYKDVLAERQAPLNAAKIA
EFSDSMIEFKADNEKYAVTVFTDITCGYCVRLHNQMQGYNDLGITVRYMAYPRQGATGPV
ADQMATIWCADDPKAAIHNAKVNRTFDNPAKDLNQCKETVQAHYNVGRQLGISGTPAIFL
PGGEMVGGYLPPADLLNRLEQQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtattacgccgactaactctgctgactttaccattttttgttaccgcttgtggg
gcggaagaaagtcaggctaaaacggaaactcctgcacaacaagttgctccaacggcgcaa
caacactttgatgaagcagcattaaaagcaaagttttcaaaacttggcttatccattgtg
gatatcaaaccatcagacgtcacaggtttgttagaaatccaaaccaatggtggcatttta
ttcgcgtctaatgatggcaatcactttatcgctggtaccttgtatgcgattgatgaaaat
ggtggttataaagatgtgctggccgagcgtcaggcaccactcaatgctgcgaagattgcg
gaattttctgacagcatgattgagttcaaggctgataatgaaaagtatgcagtgacggta
tttaccgacattacatgtggttactgcgtgcgtctgcataaccaaatgcagggctacaat
gatttaggtattaccgtccgctacatggcttacccacgccaaggcgcaacggggcctgtt
gctgatcaaatggcaacaatttggtgtgcagatgatccgaaagccgctatccacaatgcg
aaagtaaatcgtactttcgacaaccctgcgaaggacttgaatcagtgtaaagaaacggtt
caggcacattacaatgtaggtcgacagcttggtatttctggtacgccagcaatcttccta
cctggcggtgaaatggtaggcggctatctgcctccagcagatctactaaaccgtttagag
caacaataa

DBGET integrated database retrieval system