KEGG   Vibrio sp. EJY3: VEJY3_02465Help
Entry
VEJY3_02465       CDS       T01683                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vej  Vibrio sp. EJY3
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VEJY3_02465
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    VEJY3_02465
Enzymes [BR:vej01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VEJY3_02465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:550999..551982
Genome map
AA seq 327 aa AA seqDB search
MGPLWVDVAGYELTAEDKEILEHPTVGGLILFTRNYHDSEQLQALTQSIRKAAKRPLLIG
VDQEGGRVQRFREGFSLIPAADEYAKHQNSEELARMGGWLMAAELIAHDIDLSFAPVLDK
GHQCKAIGSRAFGEDADTILRHSTAYMQGMKSIGMATTGKHFPGHGGVIADSHLETPYDE
RSDIFEQDMAIFKAQIEAGILDAMMPAHVIFPNYDSQPASGSEYWLKTILRQQLGFKGLI
FSDDLTMEGAVIMGGPAERSIQALNAGCDMLLMCNKREAQVAALDNLPITSVPQASALLK
KQSFSLSELKLSQEWKQASEAMKRLTP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggtccgttatgggttgacgttgcaggctatgagctgactgctgaagacaaagaaatt
ttggagcatccaacggttggtggcttgattctgtttacacggaattatcatgatagcgag
caacttcaggcgcttacccagtctatccgcaaagcggcgaaacgtccgctactgattggt
gtcgatcaggaaggagggcgcgtacagcgatttcgtgagggcttttctcttatccctgct
gctgatgaatatgcaaaacatcaaaatagtgaagagcttgctcgaatgggcggctggctt
atggcagcggagctgattgctcatgacattgatttgagcttcgcccctgtattggataaa
ggccatcagtgtaaagcgattggaagtcgggcttttggcgaagatgcagatactatcctt
cgtcatagcactgcttacatgcaagggatgaaaagcatcggtatggcgacaacaggcaaa
cactttcccggacatggtggcgtgattgctgactctcatctggaaacgccctatgacgag
cgcagtgacatttttgagcaagacatggcgattttcaaagctcagatcgaggcgggtatt
ttggatgccatgatgccagctcacgtcatttttccgaactacgactctcaacctgccagc
ggttccgaatattggctgaaaacaattctgcgtcagcaacttggtttcaaaggtttgatc
ttctctgatgacttgaccatggaaggcgcggttatcatgggcggtcctgcagaacgctcc
attcaggctttgaatgcagggtgcgatatgctgttgatgtgcaataaaagagaggctcag
gtcgcagctctggacaacttacctatcacgagtgtgccgcaagccagcgcgttactgaaa
aaacagagcttttctctgagtgagctcaagttgtcacaagagtggaaacaagccagcgaa
gcgatgaagcgtttaactccataa

DBGET integrated database retrieval system