KEGG   Vibrio sp. EJY3: VEJY3_02665Help
Entry
VEJY3_02665       CDS       T01683                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vej  Vibrio sp. EJY3
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEJY3_02665
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEJY3_02665
   00630 Glyoxylate and dicarboxylate metabolism
    VEJY3_02665
Enzymes [BR:vej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VEJY3_02665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:603679..605307
Genome map
AA seq 542 aa AA seqDB search
MLAQTEQKTQPTKQTQGMLEVTGALAPEHQAIFPSEAQTFLSLLCEKYAGRVEQLLQARE
EKQARIDAGELPDFLPETQDIREGSWKILGIPQDLQDRRVEITGPTDRKMVINALNANVK
VFMADFEDSMSPAWTKVLDGQVNLRDAVNGTISYTNPGNGKHYQLADDPAVLICRVRGLH
LKEKHVTWHGQIIPGALFDFALYFYNNYKTLLQKGSGPYFYIPKLQSHHEAKWWSEVFHF
TEEYFGLETGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSYIKTLKNHP
DRVLPDRQVVTMDKPFLNAYSRLLVRTCHKRGAFAMGGMAAFIPAKDQEENQKVLDKIHN
DKSLEANNGHDGTWVAHPGLADTAMEVFSNILGERSNQLEVSRSEDAPITAAELLEPCEG
ERTEQGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKSLDNG
QQVTKELFESYLKEEVEVVKQEIGEERYQAGRFEEAAQLMAKLTTSDELTNFLTIPGYDY
LD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctcagacagaacaaaaaacacaaccaacgaagcagacccaaggcatgcttgag
gttactggtgcacttgctccggaacatcaggcaattttcccttcagaggcccaaaccttc
ttatcactgctttgtgaaaaatatgccggacgtgtagaacaactgctgcaagctcgagaa
gaaaaacaagcacgcatcgatgcgggtgaactgccagactttttgccagaaacacaagac
attcgtgaaggaagctggaagatcttagggattccgcaagatctgcaagatcgccgagta
gaaatcacaggtccaacggatcgtaaaatggtgattaacgctctgaatgcgaacgtaaaa
gtatttatggcagacttcgaagactcgatgtctccagcttggaccaaggtattggatggt
caggtgaacctgcgtgatgccgtaaatggcaccatcagttacaccaatcctggcaacggt
aagcattatcagctggcagacgacccagcggtgttgatctgccgtgtacgcggccttcat
ttaaaagaaaaacacgttacgtggcacggtcagatcattccaggcgcactgtttgatttc
gcgttgtacttctacaacaactacaaaacgctactacaaaaaggcagcggcccttacttc
tacattcctaagctgcaatctcaccacgaagcgaagtggtggagtgaagtgttccatttc
accgaagaatactttggtctagaaactggcactatcaaagcgacggtgcttatcgagact
ctgcctgctgtgtttgaaatggatgagattctgttttcgcttaaagagcatatcgtaggt
ctgaactgtggccgctgggattacattttcagctacatcaaaacattaaagaaccaccca
gaccgcgtactacctgaccgtcaggttgtgacgatggataagccgttcctaaatgcctac
tcacgactactggtacgtacttgtcataaacgcggtgcgtttgcgatgggcggcatggca
gctttcattcctgcaaaagaccaggaagagaaccagaaggttctggataagattcataac
gataagtcattggaagcgaacaatggccacgacggaacttgggttgctcacccaggcctg
gcagatactgcaatggaagtattcagcaatatccttggcgagcgttcaaatcagctggaa
gtcagccgctctgaagacgcgcctattaccgctgctgaattgcttgagccttgtgaaggc
gagcgtacagaacagggcatgcgtcataacattcgtgttgcgctgcaatacattgaagct
tggatttcaggcaatggttgtgtgccaatctacggcttgatggaagatgccgctaccgca
gagatttctcgcgcttcgatctggcagtggattcaacatggtaagtcgctggataacggc
caacaagtcacaaaagagctgttcgaatcctacctgaaagaagaagtagaagttgtgaaa
caagaaatcggagaagagcgttatcaagccggtcgctttgaggaagctgcgcaattgatg
gcgaagctgacaaccagcgatgagctaacgaacttcttaaccattccaggttatgactac
ttggactaa

DBGET integrated database retrieval system