KEGG   Vibrio sp. EJY3: VEJY3_02665Help
Entry
VEJY3_02665       CDS       T01683                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vej  Vibrio sp. EJY3
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEJY3_02665
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEJY3_02665
   00630 Glyoxylate and dicarboxylate metabolism
    VEJY3_02665
Enzymes [BR:vej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VEJY3_02665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:603679..605307
Genome map
AA seq 542 aa AA seqDB search
MLAQTEQKTQPTKQTQGMLEVTGALAPEHQAIFPSEAQTFLSLLCEKYAGRVEQLLQARE
EKQARIDAGELPDFLPETQDIREGSWKILGIPQDLQDRRVEITGPTDRKMVINALNANVK
VFMADFEDSMSPAWTKVLDGQVNLRDAVNGTISYTNPGNGKHYQLADDPAVLICRVRGLH
LKEKHVTWHGQIIPGALFDFALYFYNNYKTLLQKGSGPYFYIPKLQSHHEAKWWSEVFHF
TEEYFGLETGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSYIKTLKNHP
DRVLPDRQVVTMDKPFLNAYSRLLVRTCHKRGAFAMGGMAAFIPAKDQEENQKVLDKIHN
DKSLEANNGHDGTWVAHPGLADTAMEVFSNILGERSNQLEVSRSEDAPITAAELLEPCEG
ERTEQGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKSLDNG
QQVTKELFESYLKEEVEVVKQEIGEERYQAGRFEEAAQLMAKLTTSDELTNFLTIPGYDY
LD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctcagacagaacaaaaaacacaaccaacgaagcagacccaaggcatgcttgag
gttactggtgcacttgctccggaacatcaggcaattttcccttcagaggcccaaaccttc
ttatcactgctttgtgaaaaatatgccggacgtgtagaacaactgctgcaagctcgagaa
gaaaaacaagcacgcatcgatgcgggtgaactgccagactttttgccagaaacacaagac
attcgtgaaggaagctggaagatcttagggattccgcaagatctgcaagatcgccgagta
gaaatcacaggtccaacggatcgtaaaatggtgattaacgctctgaatgcgaacgtaaaa
gtatttatggcagacttcgaagactcgatgtctccagcttggaccaaggtattggatggt
caggtgaacctgcgtgatgccgtaaatggcaccatcagttacaccaatcctggcaacggt
aagcattatcagctggcagacgacccagcggtgttgatctgccgtgtacgcggccttcat
ttaaaagaaaaacacgttacgtggcacggtcagatcattccaggcgcactgtttgatttc
gcgttgtacttctacaacaactacaaaacgctactacaaaaaggcagcggcccttacttc
tacattcctaagctgcaatctcaccacgaagcgaagtggtggagtgaagtgttccatttc
accgaagaatactttggtctagaaactggcactatcaaagcgacggtgcttatcgagact
ctgcctgctgtgtttgaaatggatgagattctgttttcgcttaaagagcatatcgtaggt
ctgaactgtggccgctgggattacattttcagctacatcaaaacattaaagaaccaccca
gaccgcgtactacctgaccgtcaggttgtgacgatggataagccgttcctaaatgcctac
tcacgactactggtacgtacttgtcataaacgcggtgcgtttgcgatgggcggcatggca
gctttcattcctgcaaaagaccaggaagagaaccagaaggttctggataagattcataac
gataagtcattggaagcgaacaatggccacgacggaacttgggttgctcacccaggcctg
gcagatactgcaatggaagtattcagcaatatccttggcgagcgttcaaatcagctggaa
gtcagccgctctgaagacgcgcctattaccgctgctgaattgcttgagccttgtgaaggc
gagcgtacagaacagggcatgcgtcataacattcgtgttgcgctgcaatacattgaagct
tggatttcaggcaatggttgtgtgccaatctacggcttgatggaagatgccgctaccgca
gagatttctcgcgcttcgatctggcagtggattcaacatggtaagtcgctggataacggc
caacaagtcacaaaagagctgttcgaatcctacctgaaagaagaagtagaagttgtgaaa
caagaaatcggagaagagcgttatcaagccggtcgctttgaggaagctgcgcaattgatg
gcgaagctgacaaccagcgatgagctaacgaacttcttaaccattccaggttatgactac
ttggactaa

DBGET integrated database retrieval system