KEGG   Vibrio sp. EJY3: VEJY3_02670Help
Entry
VEJY3_02670       CDS       T01683                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
vej  Vibrio sp. EJY3
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEJY3_02670
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VEJY3_02670
Enzymes [BR:vej01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     VEJY3_02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:605439..606749
Genome map
AA seq 436 aa AA seqDB search
MTLTRRQQIEALEKDWATNPRWKNVKRTYTAEEVVELRGSMVPANTIAQRGADKLWSLVN
GSAKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNTASTMYPDQSLYPVDSVP
SVVKRINNSFRRADQIQWAGGKSPEDEGGIDYFLPIVADAEAGFGGVLNAYELMKSMIEA
GAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVAGTTTLVIARTDANAA
DLLTSDCDPYDKDFIEGERTQEGFYRVRAGIDQAISRGLAYAPYADLIWCETATPCLEEA
RKFAEAIHAEYPEQLLAYNCSPSFNWEKNLDAETIAKFQQELADMGYKYQFITLAGIHNM
WFNMFELAHAYAQGEGMRHYVEKVQRPEFQAAEKGYTFVAHQQEVGTGYFDRMTNTIQGG
NSSVTALTGSTEEDQF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacattaactcgccgccaacaaattgaagctctagaaaaagactgggcaacgaatcca
cgctggaaaaacgtgaaacgtacttacactgctgaagaagttgttgaacttcgtggctct
atggttcctgcaaacacaattgcacagcgtggtgcagacaaattgtggtcactggtcaac
ggtagcgcgaaaaagggctacgttaactgtctgggcgcgctaactggcggccaagcggtt
caacaagcaaaagcaggtatcgaagcgatttacctttctggttggcaggttgctgcagat
aacaacactgcatcaacaatgtacccagaccaatcgctatacccagtagattcagtacct
tctgttgttaagcgtatcaacaactctttccgtcgtgctgaccaaattcagtgggctggc
ggcaagtctccagaagacgaaggtggtatcgattacttcctacctatcgtagcggatgct
gaagcgggctttggtggtgtactaaatgcttacgaactgatgaaatctatgattgaagca
ggtgcggcgggcgttcacttcgaagaccaacttgcttcagtgaagaagtgtggtcacatg
ggcggtaaagttctggttccgactcaagaagcggtacaaaaactggttgcggctcgtctg
gctgcagacgtagcaggtacaacaacactcgttatcgctcgtactgatgcgaacgcagca
gacctactaacgtcagattgcgacccatacgataaagactttatcgaaggtgagcgtact
caagaaggtttctaccgtgtacgtgctggcattgaccaagcaatctctcgtggtcttgct
tacgcaccatacgcagatttgatctggtgtgaaacagcaacgccttgtctggaagaagcg
cgtaagtttgcagaagcgattcacgcagagtacccagaacagctgctagcttacaactgt
tctccatcgttcaactgggagaaaaacctggatgcagagacaattgctaaattccagcaa
gagcttgcagacatgggctacaagtaccagttcattactctagcgggaattcacaacatg
tggttcaacatgtttgaactggcacatgcttatgctcaaggtgaaggtatgcgtcactac
gttgagaaagtacagcgcccagagttccaggctgcagaaaaaggttacacattcgtagct
caccagcaagaagttggtacaggttacttcgacagaatgaccaatacgatccaaggtggt
aactcatcagttacggcactaacgggttcgactgaagaagaccaattttaa

DBGET integrated database retrieval system