KEGG   Vibrio sp. EJY3: VEJY3_03400Help
Entry
VEJY3_03400       CDS       T01683                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
vej  Vibrio sp. EJY3
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VEJY3_03400 (ipk)
Enzymes [BR:vej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     VEJY3_03400 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(774562..775449)
Genome map
AA seq 295 aa AA seqDB search
MEHHPMIDISTRWPSPAKLNLFLYINGRTENGYHELQTLFQFVDHGDELTIQANKTGNIT
LSPEIEGVPLQDNLIWKAATALQEYAQCHLGAHIDLKKVLPMGGGIGGGSSNAATTLVAL
NYLWQLNLSDDELAQIGLKLGADVPVFVRGFAAFAEGVGEKLSPAYPEEKWYLVVRPNVS
IATVDVFRHPDLTRNTAKRDLATLLDTPNVNDCEKIVRMLYPEVDKQLSWLLQYAPSRLT
GTGSCVFAEFSSKSEAETLLAQLSDDVSAFVAQGRNISPLKETLAEYQSATHRPN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcacccaatgatcgacatttcaacccgctggccttcaccggcgaaattgaat
ctctttctttacatcaatggccgaaccgaaaacggttatcacgaactccaaacgcttttc
caattcgtggatcatggtgacgaactcaccattcaagccaataaaacaggaaacatcacc
ctatctccggaaattgaaggtgttcctcttcaagataatttgatttggaaggccgcgact
gcgctgcaagaatacgcacaatgtcatttaggtgcgcacattgatcttaaaaaagttttg
ccgatgggcggtgggattggtggaggttcatcgaacgccgcgacaactctggtggcactt
aattacctttggcaactgaatctcagtgatgatgaacttgctcaaattggcttgaaactt
ggcgctgacgtgccagtatttgtacgtgggtttgctgcctttgctgaaggtgtcggagaa
aaactttctccggcttatccggaagaaaagtggtacctcgtcgtaagacctaacgtctcg
atcgcgaccgttgacgtatttcgtcacccagatttaacacgaaacaccgcaaaacgagat
ctagccacacttttggacacaccaaacgtaaacgattgcgaaaaaattgtccgaatgctc
tatccggaggttgataagcaactttcttggctgctacaatacgcgccgtcaagattgact
gggacaggatcttgcgtttttgctgaattttcgagcaaatcagaagcagaaactctcctt
gcgcaactctctgatgatgtctcggcatttgtcgctcaagggcgcaatatttcgccatta
aaagagactctggctgaataccaatcagccacacaccgacctaattaa

DBGET integrated database retrieval system