KEGG   Vibrio sp. EJY3: VEJY3_03860Help
Entry
VEJY3_03860       CDS       T01683                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vej  Vibrio sp. EJY3
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEJY3_03860
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VEJY3_03860
  Amino acid metabolism
   00310 Lysine degradation
    VEJY3_03860
Enzymes [BR:vej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     VEJY3_03860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:869959..871164
Genome map
AA seq 401 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKQPGDVIERDEVLVDIETDKVVLEVPAPEAGVLEAIV
ELEGATVLSKQLLAKIKPGAVAGEPTADKTEGTQASPDKRHKAALTEESNDALSPAVRRL
LAEHNLEAGQVKGTGVGGRITREDIEAHLANAKAATKAEAPVVEAPAAARSEKRVPMTRL
RKTVANRLLEAKNSTAMLTTFNEVNMKPIMDLRKQYKDQFEERHGTRLGFMSFYVKAVTE
ALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVTPVLKDCDTLGFADIEKGIKELAI
KGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPPQSAILGMHKIQERPMAVNGKVEI
LPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARLLLDV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgaaattctggttccagatttacctgaatcagttgcagatgcaaccgttgcg
acatggcacaaacaaccaggcgacgttattgagcgtgatgaagtactggttgatatcgaa
acagataaagtagtactagaagtgccagctccagaagctggtgttttagaagctattgtt
gaattagaaggtgcgacggtactgtcaaagcagcttctggctaaaatcaagccgggtgca
gttgctggtgaaccaacagcagataaaacggaaggtacacaagcatctccagataagcgt
cacaaagcggcacttactgaagagagcaatgatgcgctaagcccagcagttcgtcgtctt
ctggctgaacacaacctagaagctggccaagtgaaaggcactggtgttggcggtcgtatc
actcgtgaagatattgaagcgcacctagcaaacgcaaaagctgcaacaaaagctgaagcg
ccagtagttgaagctccagcagcggcacgtagtgaaaaacgcgtaccgatgactcgccta
cgtaagacagttgctaaccgtcttctagaagcgaaaaacagcacagcgatgctaacgacg
tttaacgaagtgaacatgaaaccaatcatggatcttcgtaagcagtacaaagaccagttc
gaagagcgtcacggtacacgtctaggcttcatgtctttctacgtgaaagccgtaactgaa
gcgctaaaacgttacccagaagtaaacgcgtctatcgatggcgatgatatcgtttaccac
aactacttcgacatcagcatggcggtatctacgccacgtggtctggtaactccagtactg
aaagactgtgacacgctaggttttgctgatatcgaaaaaggtatcaaagagctagcgatt
aaaggtcgtgacggcaaattaacagtagatgagctaatgggcggtaacttcactatcact
aacggtggtgtgttcggttcactaatgtctacgcctatcatcaacccaccgcaatcggcg
attcttggtatgcacaaaatccaagagcgtccaatggctgtgaacggtaaggttgaaatc
ctgccaatgatgtacctagcgctatcttacgatcaccgtttaatcgatggtcgtgagtca
gttggcttcctagtaaccattaaagagctactagaagatccagcacgtctcctattagac
gtttaa

DBGET integrated database retrieval system