KEGG   Vibrio sp. EJY3: VEJY3_04885Help
Entry
VEJY3_04885       CDS       T01683                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
vej  Vibrio sp. EJY3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vej00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VEJY3_04885 (ruvA)
Enzymes [BR:vej01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     VEJY3_04885 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1115367..1115981
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGTLLEKQPPEVLIEVNGIGYEVQMPMSCFYELPNIGEEAIIYTHFVVREDAQLL
YGFNTVKERALFREVIKANGVGPKLGLGILSGMTASQFVTCVEREDVSTLVKLPGVGKKT
AERLVVEMKDRLKGWGAGDLFTPFTDAAPADSAMAASNNAEEEAVSALLALGYKPTQASK
VVSQIAKPDMNSEQLIREALKSMV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtcttcgcggcaccttgctagaaaagcaacctcctgaagttttaattgaa
gttaacggcattggttatgaagttcagatgccaatgagctgtttctacgagctgccaaac
atcggcgaagaagccatcatttatactcattttgttgttcgcgaagatgctcagctgctt
tacggtttcaataccgtaaaagagcgtgcgttgttccgtgaagtgattaaagcaaacggc
gtgggccctaaattgggcttgggcattttgtctggtatgacagcaagtcagtttgttaca
tgcgttgaacgagaggatgtatcaacactcgttaagctgccgggcgttggtaagaaaacg
gctgagcgccttgtggttgaaatgaaagaccgtctgaaagggtggggtgctggtgatctc
tttaccccatttaccgatgccgcaccggcagattccgcaatggctgcatctaacaacgca
gaagaagaggcggtgagtgcactgcttgctctgggttacaaaccaacgcaagcctcgaaa
gtcgtgtctcaaatcgcgaaaccggatatgaacagcgagcagctgatccgtgaagcgcta
aaatcaatggtgtaa

DBGET integrated database retrieval system