KEGG   Vibrio sp. EJY3: VEJY3_04985Help
Entry
VEJY3_04985       CDS       T01683                                 

Definition
methylamine utilization protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vej  Vibrio sp. EJY3
Brite
Enzymes [BR:vej01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VEJY3_04985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1132519..1133682)
Genome map
AA seq 387 aa AA seqDB search
MSANHKFGLLASLTIFTIVGCDSESSYNATPSNPVNEFGFDFQTGSLPKPKEPSDNVATE
EKFQLGRHLFYDTKLSGNQTMSCESCHQQALAFSDGVKLPTGSTGEVLHRNSQTLTNVAY
NASYTWANPILKEIEQQLVIPLFGEFPVELGINDSNRTKILERFATDVRYQNLFNAAFPD
QQDTVTFPNIIKALGVFTRALISKDSDFDRGTMSSAAMRGQDLFNSEKTECFHCHSGFNF
SDSTLHDDSVFVSRPFFNTGLYNLDSEGSYPTEDNGLFTVTQAPKDKGKFRPPTLRNVAY
TAPYMHDGSIETLGEVLDFYANGGRNITSGENQGDGRNNPNKSEFVKGFTLSQEEKEDML
AFLNALSDEVFISNPRYANPFVGEEAQ
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaaccacaagttcggtttgctggcatcgctcacgatattcacgatcgtaggc
tgtgacagcgaatcgagttataacgccacaccatcaaacccggtgaatgagtttggtttt
gactttcaaaccggctctcttcctaagcctaaagaaccgtcagataacgtggcaactgag
gaaaaattccaacttggcagacatcttttttatgacactaagctttctggcaaccagaca
atgtcatgcgaatcctgccaccagcaggcactggcgttttctgatggggtaaaactacca
actggttcaacgggtgaagtgctgcataggaactcccaaacattaaccaatgtggcctac
aacgcatcttacacctgggcgaacccaatcttgaaagagattgaacagcagttggtgatt
cctctctttggagagtttcctgtcgaactgggcattaacgattcaaatcgaaccaagatt
ctggagcgctttgctactgatgtcaggtatcaaaacttgtttaatgccgcgtttcccgac
cagcaggatacggtgaccttccctaacatcatcaaagcactcggtgtgtttactcgcgca
ttgatttcgaaagactctgattttgatcgcggcacgatgagcagtgctgcgatgcgtggg
caagatctttttaacagcgagaaaacggaatgtttccattgtcatagcgggtttaatttt
agtgattcaactctgcacgatgattctgtgtttgtctctcggccgttttttaatactggg
ttatacaaccttgattcggaggggagttatcccactgaggacaacggcttgttcaccgta
acgcaagctcctaaagacaaaggaaagttccgaccaccaacgctgagaaatgtcgcttac
accgcgccgtatatgcacgatggaagcatcgaaactctcggtgaggtattggatttctac
gccaatggcggaagaaatatcacctcgggtgagaatcagggagacgggcgcaataacccg
aataaaagtgaatttgttaaaggtttcacgttaagccaagaggaaaaagaagacatgctg
gcgtttttaaatgcgttaagcgatgaggtgttcatctccaacccccgctatgccaaccca
tttgttggggaggaagcgcaatga

DBGET integrated database retrieval system