KEGG   Vibrio sp. EJY3: VEJY3_06085Help
Entry
VEJY3_06085       CDS       T01683                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
vej  Vibrio sp. EJY3
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VEJY3_06085
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    VEJY3_06085
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VEJY3_06085
Enzymes [BR:vej01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     VEJY3_06085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1376220..1377893
Genome map
AA seq 557 aa AA seqDB search
MSISRRDFMKAVSSTAVTAGLIGCGSDSSELVVGSFDHGVASGDPTQTQVIIWTRVTTDG
DYADVTWQVASDEGFSDVVQSSVFTTDTSRDFTVKVDVKNLNPNTHYYYRFMIGEVVSGV
GETKTLPDESVEQASMAVVSCANYPAGYFNVYREILNQHKEASFDVVLHLGDYIYEYGAG
GYASEDAETLDRVASKGTECVTLDDYRKRYAQYRQDADLQALHAKLPMIAVWDDHELAND
AWKEGAENHQDDEGSFNDRRAAAAAAWTEWLPVRENSYSSMLIYRQFSFGNLVKLMMLDT
RLVGRDEPLDYFSLSEPSIEAIAGLVAESRSVDRELLGSDQLAWLMNEFTTSNAKWNVLG
QQVLMSKMELPSSVMTAMFQLFTATEDQQAAALLAVNTAITNYLSDPSSDPVSLPYNLDA
WDGYYVEREKVYQLANASAGNFVCLAGDTHNAWASALHDISGTPVGVEFATSSVSSPGLE
AYLAMDSTVTAQMEFTLPHLVSELKWTDIKQRGFMRVTFTPDNAQSTWYFVSTIKSKDYQ
VTTKSASTTDGITLNIV
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttctcgtcgagatttcatgaaagcagtttcttcgaccgcagttacagccggg
ctcattggctgtggtagtgatagctctgaattagtagtgggttcctttgatcatggcgtc
gccagtggcgatccgactcaaactcaagtcatcatctggacgcgtgttaccacggatggg
gactatgctgatgtgacatggcaagttgcctcagatgagggcttttcagatgtggtacaa
agtagtgtgttcactacggataccagtcgtgattttaccgtaaaagtcgatgttaaaaac
ctcaacccgaatactcactattactaccgttttatgattggtgaggtggtaagcggagtc
ggagagaccaaaactctaccggatgaaagtgtcgaacaggcatcaatggcggttgtgtct
tgcgcaaattatccggctggatatttcaatgtctatcgcgagattttaaatcagcacaaa
gaggcttcatttgatgtggtgctgcatttaggggactacatctatgaatatggtgctggt
gggtatgccagtgaagacgctgagacattagatcgagtggcaagtaaaggcacggagtgc
gtaacgttagatgactaccgaaaacgatacgcccaatatcgccaagatgctgatcttcag
gcgttacatgcgaaattaccgatgatcgcggtatgggatgaccacgaactcgcgaatgat
gcgtggaaagaaggcgccgaaaaccatcaagatgacgaaggcagttttaatgacagacgc
gcagcggcagcggcggcgtggactgagtggttgcccgtacgagagaatagctattcaagt
atgctgatctatcgccagttctcctttggtaacttagtgaaattgatgatgctcgatact
cgattagttggtcgtgatgagccattggattacttttcgttaagtgaaccaagcatagaa
gccattgcaggcttggtcgctgagtcacgaagtgtcgacagagagctacttggctctgat
caactggcttggttgatgaatgaatttacgacgagtaatgccaaatggaatgtattgggg
caacaggttctgatgtctaaaatggagttaccaagctctgtcatgactgctatgttccaa
ctgtttaccgcgaccgaagatcaacaagctgcggctttattggccgtgaatacagccatt
actaactatctgtctgacccaagttcagatcccgtctctttgccttataacctcgatgct
tgggatggttactacgtagagcgagagaaagtttaccaattagcgaatgctagtgctggc
aattttgtctgtttagcgggcgatacgcacaatgcatgggcgagtgctttgcatgacatt
tcaggtactcctgtcggtgttgaatttgcaaccagctcagtcagttcaccgggtttggaa
gcgtatttagccatggactcaacagtaactgcccaaatggagttcactttgccgcattta
gtctcagagctaaagtggacggatattaaacaacggggctttatgcgagtgacgtttacg
cctgataatgcgcagtcgacttggtattttgtgtcgaccattaaatcgaaagactatcag
gtcacgacaaagtcggcttcgacgacagacggtattacgttaaatattgtttaa

DBGET integrated database retrieval system