KEGG   Vibrio sp. EJY3: VEJY3_06800Help
Entry
VEJY3_06800       CDS       T01683                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
vej  Vibrio sp. EJY3
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VEJY3_06800
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEJY3_06800
   00650 Butanoate metabolism
    VEJY3_06800
  Amino acid metabolism
   00360 Phenylalanine metabolism
    VEJY3_06800
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VEJY3_06800
   00622 Xylene degradation
    VEJY3_06800
   00621 Dioxin degradation
    VEJY3_06800
Enzymes [BR:vej01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VEJY3_06800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1522662..1523597
Genome map
AA seq 311 aa AA seqDB search
MKTMKVAIIGSGNIGTDLMIKVLRNSQHLTMSVMVGIDPESDGLARARRMGVTTTHEGVE
GLIKLPEFNDIDIVFDATSANAHISNDALLREAKPGIKLIDLTPAAIGPYCVPVVNLEQN
LAKNNVNMVTCGGQATIPVVAAVAQVATVHYAEIIASISSKSAGPGTRANIDEFTETTSK
AIETVGGAKKGKAIIILNPAEPPLMMRDTVHVLCDSKDEDKVRASIEEMVSAVQSYVPGY
RLKQAVQFESIGEDKPATLPGYGEFSGLKVSAFIEVEGAAHYLPAYAGNLDIMTCAAMAT
AERIAQSCLNQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatgaaggtagcgattattggctcaggcaatatcggcactgacttaatgata
aaagtgctgcgcaatagccaacatttgaccatgagtgtcatggttgggattgacccagaa
tcggatggcctggccagagcacgtcgaatgggggttaccaccactcatgaaggtgtggaa
ggtttgattaaattgccagagtttaatgacatcgatatcgtttttgatgcgacgtcggct
aacgcgcacatcagtaatgatgcccttctgcgtgaggcgaaaccaggcattaagctgatt
gacttaactccggcagcgattggtccttattgcgttccagtcgtgaatctggaacaaaac
cttgcgaagaataacgtcaatatggtcacttgtggcggtcaggcaaccattcctgttgtt
gcggcggtagcgcaagtagccaccgtgcattatgcagagattattgcgtcgatcagcagt
aaatcggcaggaccaggtacgcgcgcgaatatcgacgagtttaccgaaaccacttctaaa
gccattgaaacagtaggcggtgcgaaaaaaggtaaggcgatcatcattctgaacccggca
gagccacctctgatgatgcgtgacactgtccacgtactttgtgacagcaaagatgaagac
aaagtccgcgcatcaattgaagaaatggtcagcgcggttcaaagctacgtgccgggttac
cgtttaaaacaagcggtgcagtttgaatcgattggcgaagacaagccagctacgcttccg
ggttacggtgagttcagtgggctcaaagtgtctgcctttattgaagtcgaaggggctgcc
cattatctccctgcttatgctggcaacctcgatattatgacttgtgcggctatggcgacc
gcagaacgtatcgctcaatcttgtctgaaccaataa

DBGET integrated database retrieval system