KEGG   Vibrio sp. EJY3: VEJY3_08390Help
Entry
VEJY3_08390       CDS       T01683                                 

Definition
racemase
Orthology
K01779  
aspartate racemase [EC:5.1.1.13]
Organism
vej  Vibrio sp. EJY3
Pathway
Alanine, aspartate and glutamate metabolism
Nonribosomal peptide structures
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:vej00250]
Metabolism; Metabolism of terpenoids and polyketides; Nonribosomal peptide structures [PATH:vej01054]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1866340..1867035)
Genome map
AA seq 231 aa AA seqDB search
MKTVGMVGGMSWESTASYYKALNEGVKSRLGGLHSAKICLYSVDFDEIEKLQHQGKWSET
ALILAEAAKSVERGGADFLMICTNTMHKVVPEIESQISIPILHIADATAESLVQNGVTKV
GLLGTRFTMEQDFYKGRISEKFGIDVVVPTADEQTVVHDIIYQELCLGEIKTESRDRYLK
IIANLHAQGAQAVILGCTEIALLVKQSDTAVPLYDTTEIHAAHGVEWALGN
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaagacagtaggcatggtaggtggaatgagctgggaatccaccgccagttattacaaa
gcactgaatgaaggcgtgaagtcaaggttaggtggcttgcactcagcaaaaatctgctta
tacagtgtcgactttgacgaaattgaaaaactccagcatcaagggaaatggtcagaaacc
gctttgatccttgccgaagcagccaagtcagtagaacgtggtggcgcagattttttaatg
atatgcacgaacacaatgcataaagttgtaccagaaattgagtcacagatatctattcca
attttacatattgctgatgcgaccgcagagagcctggttcaaaacggtgtcactaaagtt
ggtctgttgggaacgcgttttacaatggagcaagatttctacaagggcaggatctcagag
aaatttggcatagacgtggttgttcctactgccgatgagcaaaccgtcgttcacgatatt
atttatcaagagctttgcctgggtgaaataaaaaccgagtcgcgagaccgttacttgaaa
atcattgccaatttacacgctcagggtgctcaagcggtgattctgggatgtactgaaatt
gcattattagtgaagcaaagtgacacggcggttcctttgtatgacaccacggaaattcat
gcagcgcatggcgttgaatgggcattaggaaattaa

DBGET integrated database retrieval system