KEGG   Vibrio sp. EJY3: VEJY3_10275Help
Entry
VEJY3_10275       CDS       T01683                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vej  Vibrio sp. EJY3
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VEJY3_10275
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VEJY3_10275
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VEJY3_10275
Enzymes [BR:vej01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VEJY3_10275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:2276225..2277415
Genome map
AA seq 396 aa AA seqDB search
MAKLNAYFGEYGGQYVPQILVPALEQLEQAFIDAQEDPEFRSEFMTLLQEYAGRPTALTH
TRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSATLKDACNEALRDWSATY
EDAHYLLGTAAGPHPFPTIVREFQRMIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEESVRLIGVEPAGKGIDTDQHGAPLKHGKTGIYFGMKAPIMQDENGQIEESYSVS
AGLDFPSVGPQHAYLNSIGRAEYANVTDDEALDAFQEIARSEGIIAALESSHALAHALRM
ARENPEKEQLLVVNLSGRGDKDIFTVNAILEEKGVI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgaatgcctactttggcgaatatggcggtcagtacgttccgcaaatcctc
gttcctgcattggagcaacttgagcaagcgtttattgacgcacaggaagatccagagttc
cgtagcgaattcatgacacttcttcaggaatatgcaggtcgccctacggcgctaacgcat
acccgcaacttaactaaaggtacaaagaccaaactgtacctaaagcgtgaagacttactc
cacggcggcgcacacaaaactaaccaggtgctaggtcaggctctactggctaagcgcatg
ggcaaaacagaaatcatcgctgaaaccggtgcgggtcaacacggtgtcgcaacagcacta
gcatgtgcgctacttggtctaaaatgtcgcgtttatatgggtgcgaaagacgttgagcgt
caaagcccgaacgtgttccgcatgaaactcatgggcgctgaagtcattccggtacattct
ggttcggcaacacttaaagatgcgtgtaatgaagcactgcgtgactggtcagcaacgtac
gaagacgcgcactacctactaggtacggcagcgggccctcacccgttcccaactatcgtt
cgcgagttccagcgtatgattggtgaagaaaccaagaaccagattctggctcgtgaagga
cgtcttccagatgcagttatcgcttgtgtaggcggtggctctaacgccattggtatgttt
gctgatttcatcgaagaagaaagtgttcgccttattggagtcgaacctgcaggtaaaggt
atcgataccgaccaacacggtgcgccgctgaaacacggtaagacaggcatttatttcggt
atgaaagcgccaatcatgcaagatgaaaacggacagatcgaagagtcctactccgtttct
gctggtctagattttccatctgttgggcctcagcacgcttacttgaattccattggccgt
gcggaatacgccaatgtaaccgatgatgaagccttggatgctttccaggaaattgcgcgt
agtgaaggtatcattgcggcacttgaatcgtctcacgcacttgcacacgcgttgcgtatg
gctcgcgaaaatccagaaaaagagcagcttttagtcgtcaacttatccggtcgtggtgac
aaagacatcttcaccgtaaacgccatcctagaagaaaaaggagtgatctaa

DBGET integrated database retrieval system