KEGG   Vibrio sp. EJY3: VEJY3_10280Help
Entry
VEJY3_10280       CDS       T01683                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vej  Vibrio sp. EJY3
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VEJY3_10280 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VEJY3_10280 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VEJY3_10280 (trpA)
Enzymes [BR:vej01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VEJY3_10280 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:2277415..2278221
Genome map
AA seq 268 aa AA seqDB search
MSRYEKMFARLNEKNQGAFVPFVTVGDPNAEQSYKIMETLVESGADALELGIPFSDPLAD
GPTIQGANKRALESGATPSICFEQIGKIRAQYPDLPIGLLMYANLVYSRGIENFYEHCAK
AGIDSVLIADVPTNESAEFVAAAEKFGIHPIFIAPPTASDETLEQVAELSGGYTYLLSRA
GVTGTETKANMPVGQLLERLNQFDAPPALLGFGISEPEQVKQAIEAGAAGAISGSAVVKI
IETHAEQPQIMLDKLGEFVSAMKAATQK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgttatgagaagatgtttgctcgcctgaatgaaaagaaccaaggcgcgtttgta
ccgttcgtaacggtaggtgatccaaatgcagaacaatcatacaaaattatggaaaccctt
gttgaatcgggtgctgacgcacttgagctgggcattccgttttctgacccactagcagat
ggcccgacaattcagggagcaaataaacgtgcactggagtctggcgcaacaccaagtatc
tgctttgagcaaattggcaagattcgcgcccaatacccagatctaccaatcgggctattg
atgtatgcgaacttggtttactctcgcggtattgaaaacttttacgaacactgtgccaaa
gccggtatcgactctgttctgattgccgacgtaccaaccaatgaaagcgcagagttcgtc
gcagccgcagagaagtttggcattcatccgatctttattgcaccaccaacggccagcgac
gaaaccctggagcaagtggcagagctaagtggcggttatacctacctactttctcgagcg
ggtgtaacagggacagaaacgaaggcaaatatgcctgttggacagttgttagagagacta
aaccaattcgatgctccaccagcgttacttggcttcggtatctctgagccagaacaagtg
aaacaagcaatagaggctggtgccgctggcgccatctctggttcagccgtggttaaaatc
attgagacgcacgcagagcagccacagattatgctggacaagcttggtgagtttgtttcg
gcaatgaaggccgctactcaaaaataa

DBGET integrated database retrieval system