KEGG   Vibrio sp. EJY3: VEJY3_10830Help
Entry
VEJY3_10830       CDS       T01683                                 

Definition
phosphate acetyltransferase
Orthology
K13788  
phosphate acetyltransferase [EC:2.3.1.8]
Organism
vej  Vibrio sp. EJY3
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Class
Metabolism; Overview; Carbon metabolism [PATH:vej01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vej00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:vej00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:vej00680]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:vej00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2410284..2412428
Genome map
AA seq 714 aa AA seqDB search
MSRTIMLIPASAGVGLTSVSMGVLRAMERKGVKVSFYKPICQPRSGGDQPDLTSTIVGHN
SDMKIGEPMAMSVAESLIGNDNMDELLETIVERYNQINKDADVTLIEGLVPTRKHPFANQ
VNAEIAATLGAEIVLVATPGTDNPAQLKERIEVACSNFGGTKNKNISGVIINKLNAPVDE
AGRTRPDLSEIFDDADSAKQNEMKVMEIFNTSPIRVLGCVPWSIDLIATRAIDMAKHLNA
DIINKGDINTRRIKSITFCARSLPNMIEHFKPGSLLVTSADRPDVIVAASLAAMNGVDIG
AVLLTGGYDIPREIEGLCKPAFETGLPIFKAQGNTWQTSLNLQSFSIEVPADDKERIEFI
NEHVAGHIDGNWIESMTEGTQKSRRLSPPAFRYQLTELARRAGKRIVLPEGDEPRTVKAA
AICAERGIAECVLLGNPAEIRRVAAQQGVELGAGVQIIDADAIRENYVARLVELRGAKGM
TEVVAREKLQDSVFLGTMMLENNEVDGLVSGAVHTTANTIVPPFQIIKTAPNASIVSSVF
FMLLPDQVLVYGDCAINPDPTAEQLAEIAIQSADSAAAFGIDPRVAMISYSTGESGKGAD
VDKVREATKLAQEKRPDLIIDGPLQYDAAIMENVAASKAPNSPVAGKATVFVFPDLNTGN
TTYKAVQRSADLVSIGPMLQGMRKPVNDLSRGALVDDIVYTIALTAIQATQEQK
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtactattatgcttatccctgcaagtgctggtgttggtttaactagcgtaagc
atgggtgttcttcgcgctatggagcgcaaaggcgttaaagtttctttctacaaacctatt
tgtcagccacgcagtggcggcgatcaaccggatctaacttcaactatcgttggccacaac
agcgatatgaagatcggcgaacctatggcgatgtctgttgctgaaagcctgatcggtaac
gacaacatggatgagctgctagaaaccatcgttgagcgttacaaccaaatcaataaagat
gcagatgtaactctaattgaaggtctggtaccaactcgtaagcacccattcgctaaccaa
gtgaacgcggaaatcgcagcaacacttggtgctgaaattgttctagtggcaacgcctggc
acagataacccagctcagcttaaagagcgcatcgaagtagcatgttctaacttcggcggt
actaagaacaaaaacatctctggtgttatcatcaacaagctaaacgcacctgttgatgaa
gctggccgtactcgccctgacctgtctgagatctttgatgatgcagacagcgcgaagcaa
aacgaaatgaaagtgatggagatcttcaacacttctccaattcgtgtactaggttgcgtg
ccatggagcatcgacctgattgcgactcgtgctatcgacatggcgaaacacctgaatgct
gatatcatcaacaaaggtgacatcaacactcgtcgtatcaagagcatcacgttctgcgcg
cgttctctgccaaacatgattgagcacttcaaaccaggttctctacttgttacttctgca
gaccgtccagacgtaatcgttgctgcttctctagcggcgatgaacggtgttgacatcggt
gctgtactgctaaccggcggttacgacatcccacgcgaaattgaaggtctatgtaagcca
gcattcgaaacaggcctacctatcttcaaagctcaaggcaacacttggcagacttctcta
aatctacagagcttcagcattgaagtacctgcagacgacaaagagcgtatcgaattcatt
aacgagcacgttgctggtcacatcgacggtaactggatcgagtcaatgactgaaggtact
cagaagtctcgtcgtctaagcccgccagcattccgttaccagctaactgaacttgctcgt
agagctggcaagcgcatcgttcttccagaaggtgatgagccacgtaccgtgaaagctgct
gctatctgtgctgagcgcggcattgcagaatgtgtgcttctgggtaacccagcagaaatc
cgtcgcgtagctgcacaacaaggtgttgagctaggcgctggcgttcaaatcatcgacgct
gatgctatccgtgaaaactacgttgctcgcctggttgagctacgtggtgcgaaaggtatg
actgaagttgtagctcgtgagaaactacaagactcagtattcctgggcacaatgatgctt
gagaacaacgaagttgatggcctggtttctggcgctgttcacactacggcgaacactatc
gttcctccgttccaaatcatcaagactgcacctaatgcgtctatcgtttcttcagtattc
ttcatgcttctgcctgatcaagtactggtttacggtgactgtgcaatcaacccagatcca
acggctgaacagcttgctgaaatcgctatccaatcagcggattctgctgctgcattcggt
atcgacccacgcgttgcaatgatctcttactctactggtgaatctggtaagggtgcagac
gttgataaagtacgtgaagcgacgaaactagctcaagagaaacgtcctgatcttatcatc
gacggtcctctacagtacgacgcggctatcatggaaaacgttgcggcttctaaagcgcca
aactctccagtagcaggtaaagcgacagtattcgtattcccagacctaaacacgggtaac
acgacttacaaagcagtacaacgttcagcagatctagtatctatcggtccaatgctgcaa
ggtatgcgcaagcctgtaaacgacctgtctcgtggcgcgctagtagacgacatcgtgtac
acaatcgctctaacagcaatccaagcaactcaagaacagaagtaa

DBGET integrated database retrieval system