KEGG   Vibrio sp. EJY3: VEJY3_10830Help
Entry
VEJY3_10830       CDS       T01683                                 

Definition
(GenBank) phosphate acetyltransferase
  KO
K13788  phosphate acetyltransferase [EC:2.3.1.8]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00430  Taurine and hypotaurine metabolism
vej00620  Pyruvate metabolism
vej00640  Propanoate metabolism
vej00680  Methane metabolism
vej01100  Metabolic pathways
vej01120  Microbial metabolism in diverse environments
vej01200  Carbon metabolism
Module
vej_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEJY3_10830
   00640 Propanoate metabolism
    VEJY3_10830
  Energy metabolism
   00680 Methane metabolism
    VEJY3_10830
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    VEJY3_10830
Enzymes [BR:vej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     VEJY3_10830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB AAA_26 DRTGG CbiA
Motif
Other DBs
NCBI-ProteinID: AEX22646
UniProt: H2IHE3
Position
1:2410284..2412428
Genome map
AA seq 714 aa AA seqDB search
MSRTIMLIPASAGVGLTSVSMGVLRAMERKGVKVSFYKPICQPRSGGDQPDLTSTIVGHN
SDMKIGEPMAMSVAESLIGNDNMDELLETIVERYNQINKDADVTLIEGLVPTRKHPFANQ
VNAEIAATLGAEIVLVATPGTDNPAQLKERIEVACSNFGGTKNKNISGVIINKLNAPVDE
AGRTRPDLSEIFDDADSAKQNEMKVMEIFNTSPIRVLGCVPWSIDLIATRAIDMAKHLNA
DIINKGDINTRRIKSITFCARSLPNMIEHFKPGSLLVTSADRPDVIVAASLAAMNGVDIG
AVLLTGGYDIPREIEGLCKPAFETGLPIFKAQGNTWQTSLNLQSFSIEVPADDKERIEFI
NEHVAGHIDGNWIESMTEGTQKSRRLSPPAFRYQLTELARRAGKRIVLPEGDEPRTVKAA
AICAERGIAECVLLGNPAEIRRVAAQQGVELGAGVQIIDADAIRENYVARLVELRGAKGM
TEVVAREKLQDSVFLGTMMLENNEVDGLVSGAVHTTANTIVPPFQIIKTAPNASIVSSVF
FMLLPDQVLVYGDCAINPDPTAEQLAEIAIQSADSAAAFGIDPRVAMISYSTGESGKGAD
VDKVREATKLAQEKRPDLIIDGPLQYDAAIMENVAASKAPNSPVAGKATVFVFPDLNTGN
TTYKAVQRSADLVSIGPMLQGMRKPVNDLSRGALVDDIVYTIALTAIQATQEQK
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtactattatgcttatccctgcaagtgctggtgttggtttaactagcgtaagc
atgggtgttcttcgcgctatggagcgcaaaggcgttaaagtttctttctacaaacctatt
tgtcagccacgcagtggcggcgatcaaccggatctaacttcaactatcgttggccacaac
agcgatatgaagatcggcgaacctatggcgatgtctgttgctgaaagcctgatcggtaac
gacaacatggatgagctgctagaaaccatcgttgagcgttacaaccaaatcaataaagat
gcagatgtaactctaattgaaggtctggtaccaactcgtaagcacccattcgctaaccaa
gtgaacgcggaaatcgcagcaacacttggtgctgaaattgttctagtggcaacgcctggc
acagataacccagctcagcttaaagagcgcatcgaagtagcatgttctaacttcggcggt
actaagaacaaaaacatctctggtgttatcatcaacaagctaaacgcacctgttgatgaa
gctggccgtactcgccctgacctgtctgagatctttgatgatgcagacagcgcgaagcaa
aacgaaatgaaagtgatggagatcttcaacacttctccaattcgtgtactaggttgcgtg
ccatggagcatcgacctgattgcgactcgtgctatcgacatggcgaaacacctgaatgct
gatatcatcaacaaaggtgacatcaacactcgtcgtatcaagagcatcacgttctgcgcg
cgttctctgccaaacatgattgagcacttcaaaccaggttctctacttgttacttctgca
gaccgtccagacgtaatcgttgctgcttctctagcggcgatgaacggtgttgacatcggt
gctgtactgctaaccggcggttacgacatcccacgcgaaattgaaggtctatgtaagcca
gcattcgaaacaggcctacctatcttcaaagctcaaggcaacacttggcagacttctcta
aatctacagagcttcagcattgaagtacctgcagacgacaaagagcgtatcgaattcatt
aacgagcacgttgctggtcacatcgacggtaactggatcgagtcaatgactgaaggtact
cagaagtctcgtcgtctaagcccgccagcattccgttaccagctaactgaacttgctcgt
agagctggcaagcgcatcgttcttccagaaggtgatgagccacgtaccgtgaaagctgct
gctatctgtgctgagcgcggcattgcagaatgtgtgcttctgggtaacccagcagaaatc
cgtcgcgtagctgcacaacaaggtgttgagctaggcgctggcgttcaaatcatcgacgct
gatgctatccgtgaaaactacgttgctcgcctggttgagctacgtggtgcgaaaggtatg
actgaagttgtagctcgtgagaaactacaagactcagtattcctgggcacaatgatgctt
gagaacaacgaagttgatggcctggtttctggcgctgttcacactacggcgaacactatc
gttcctccgttccaaatcatcaagactgcacctaatgcgtctatcgtttcttcagtattc
ttcatgcttctgcctgatcaagtactggtttacggtgactgtgcaatcaacccagatcca
acggctgaacagcttgctgaaatcgctatccaatcagcggattctgctgctgcattcggt
atcgacccacgcgttgcaatgatctcttactctactggtgaatctggtaagggtgcagac
gttgataaagtacgtgaagcgacgaaactagctcaagagaaacgtcctgatcttatcatc
gacggtcctctacagtacgacgcggctatcatggaaaacgttgcggcttctaaagcgcca
aactctccagtagcaggtaaagcgacagtattcgtattcccagacctaaacacgggtaac
acgacttacaaagcagtacaacgttcagcagatctagtatctatcggtccaatgctgcaa
ggtatgcgcaagcctgtaaacgacctgtctcgtggcgcgctagtagacgacatcgtgtac
acaatcgctctaacagcaatccaagcaactcaagaacagaagtaa

DBGET integrated database retrieval system