KEGG   Vibrio sp. EJY3: VEJY3_11180Help
Entry
VEJY3_11180       CDS       T01683                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
vej  Vibrio sp. EJY3
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vej00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:vej00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:vej02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2487330..2488907
Genome map
AA seq 525 aa AA seqDB search
MKRLAYPVVTALAASTLSFNALSAEIKNVILMIGDGMGPQQVGLLETYANHAPHSIYKGE
TTALYKLAQEGVIGSSLTNPEDAIVVDSACSATMLATGMPTASEVIGIDSQGNHVETILE
KAKSKGKATGLVSDTRMTHATPAAFAAHQPHRSLENDIAVDMLETEVDVLLSGGLRHWIP
GSANDKGDTYKQLEKLTQGNVALKSKRKDERNLLTEAQEEGYSLAFSRDMLAEAKGDKLL
GLFANSGMADGIAYSQSKNDPKRTQPSLKEMTVKALDVLSKDEDGFFLMVEGGQIDWAGH
SNDAGTMLHEMIKFDEAVNSVYEWAKGRDDTLIVVTADHETGSFGFSYSSANLPKPEKRS
GEAFKNRDYAPNFNFGDFSILDGLYNQKTSYYGMLDKFAALPEADRTAENLAKIINENSD
FPITADQAAHIMQDKPNPYHVDGHSYLAQEQVPAIHDFDAFFPYNDRTNLIAREHATGQN
TVWGTGTHTHTPVNVFAWGPAEKILPVSKIMHHSELGEFLKQQIK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcttagcataccctgtagttaccgctcttgctgcctcaacactctctttcaat
gccctttcagcagagatcaaaaacgtcattttgatgattggtgatggcatgggccctcag
caagtaggcctacttgaaacctacgcaaaccacgccccgcactcaatttataaaggcgaa
accacagcactttacaaattggcacaagaaggtgtgattggatcttctttgactaaccct
gaagatgctatcgtagtcgactctgcttgctctgcgacgatgctagcaactgggatgcca
accgcttcagaagtaattggtattgatagccagggcaaccacgttgaaaccattttagaa
aaagccaaaagcaaaggtaaagcaacgggcttggtttctgatacgcgcatgacgcacgct
acaccagcagcctttgccgctcatcaacctcaccgttctttagaaaacgacattgctgtc
gacatgctggaaacagaagtagatgttctgctttctggtggtcttcgtcactggattcca
ggttcagcgaatgacaaaggcgacacttacaagcagcttgagaaactcactcaaggtaac
gttgctcttaaatctaaacgtaaagacgagcgcaacttgctgactgaagctcaagaagaa
ggctatagcctggcatttagccgcgatatgctggctgaagcaaaaggtgacaaattactt
ggtctttttgctaactcaggtatggccgatggcatcgcgtacagccaaagtaaaaacgat
ccaaaacgcacacaaccttctcttaaagagatgaccgtaaaagcattggatgttctatcc
aaagatgaagacggctttttcctaatggttgaaggcggacaaatcgactgggctggacac
agcaacgatgcgggcaccatgcttcacgaaatgattaagtttgatgaagcggtgaactct
gtttacgaatgggcgaaaggacgtgatgacacacttatcgtcgtgacggctgaccatgaa
actggctcttttggcttcagctattcatcagcgaatctgccaaaaccagagaagcgcagc
ggcgaagcgttcaaaaacagagactacgcgcctaactttaatttcggtgatttctctatc
cttgatggcttgtacaaccaaaaaaccagttactacggcatgttggataaattcgcagca
ttacctgaagcagatagaacagcggaaaacttagctaagatcatcaacgagaatagcgat
ttccctatcacagcggatcaagctgcgcacattatgcaagataagccaaacccatatcat
gtagacggtcatagctacctggcacaagagcaagtacctgctattcacgattttgatgcg
ttcttcccatataatgaccgcacaaacttgattgcacgtgagcatgcgactggccaaaac
acggtatggggcacaggtacccacacgcatactcctgtaaatgtatttgcttggggaccg
gctgagaaaattctccctgtatctaagatcatgcatcactctgagctgggcgaattccta
aagcagcaaatcaaataa

DBGET integrated database retrieval system