KEGG   Vibrio sp. EJY3: VEJY3_11210Help
Entry
VEJY3_11210       CDS       T01683                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
vej  Vibrio sp. EJY3
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vej03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2493219..2493818)
Genome map
AA seq 199 aa AA seqDB search
MRTSHMLEQLMEALRCLPGVGPKSAQRMAFHLLQRDRKGGLQLADALSQAMTEIGHCSEC
RTFTEEDICHICTNPKRQENGQICVVESPADIAAVEATGQYSGRYFVLMGHLSPLDGIGP
SDIGLDVLDYRLRRGDITEVILATNPTVEGEATAHYIAELCREHQVEASRIAHGVPVGGE
LELVDGTTLSHSLLGRHKL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccagtcatatgctggaacaattgatggaggccttacgttgtctacctggggtt
ggtcccaagtcggcgcagcgtatggcctttcatttgttacagcgagatagaaaaggcggc
ttacagctcgccgatgctcttagtcaggcaatgacggaaattggccattgctcagagtgc
cgcacttttactgaagaagacatctgccatatttgtaccaatcctaaaagacaggaaaac
ggtcagatctgtgtggtggaaagcccggcagacatcgcagccgtagaggcgacaggacaa
tactccggacgatactttgttttgatggggcatttatctccgcttgatggtatcggtcca
agtgatattggcttagatgtgctcgattatcgtcttcgccgaggtgatattactgaagtg
attctggctaccaatccaacggtagaaggtgaagctacggcacattacatcgcagagctg
tgcagagagcatcaagtcgaggcaagccgaattgcacatggtgttcctgttggcggtgaa
cttgaacttgttgatggcaccaccttgtcacactcactgttaggtcgacacaaattataa

DBGET integrated database retrieval system