KEGG   Vibrio sp. EJY3: VEJY3_11375Help
Entry
VEJY3_11375       CDS       T01683                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00071  Fatty acid degradation
vej00280  Valine, leucine and isoleucine degradation
vej00281  Geraniol degradation
vej00310  Lysine degradation
vej00362  Benzoate degradation
vej00380  Tryptophan metabolism
vej00410  beta-Alanine metabolism
vej00640  Propanoate metabolism
vej00650  Butanoate metabolism
vej00903  Limonene and pinene degradation
vej00930  Caprolactam degradation
vej01040  Biosynthesis of unsaturated fatty acids
vej01100  Metabolic pathways
vej01110  Biosynthesis of secondary metabolites
vej01120  Microbial metabolism in diverse environments
vej01130  Biosynthesis of antibiotics
vej01200  Carbon metabolism
vej01212  Fatty acid metabolism
Module
vej_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VEJY3_11375 (fadJ)
   00650 Butanoate metabolism
    VEJY3_11375 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    VEJY3_11375 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    VEJY3_11375 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VEJY3_11375 (fadJ)
   00310 Lysine degradation
    VEJY3_11375 (fadJ)
   00380 Tryptophan metabolism
    VEJY3_11375 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VEJY3_11375 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VEJY3_11375 (fadJ)
   00281 Geraniol degradation
    VEJY3_11375 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VEJY3_11375 (fadJ)
   00930 Caprolactam degradation
    VEJY3_11375 (fadJ)
Enzymes [BR:vej01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VEJY3_11375 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VEJY3_11375 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VEJY3_11375 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AEX22753
UniProt: H2II62
Position
1:complement(2535431..2537542)
Genome map
AA seq 703 aa AA seqDB search
MSEQKAFSLKIDEQNIAWLAIDVPNEKMNTLQAAFVEDMQEIFAQLKDSTGVKGMIIHSL
KPDNFVAGADVRMLDACTTASEAEALAKQGQELFQQLSDLPYPVVAAIHGPCLGGGLELA
LACDYRVCTESDITRLGLPEVQLGLLPGSGGTQRLPRLIGLLPSLDLILTGKQLRAKKAK
KLGVVDACVPETILLDVAKQFIDKGKSKGKKKQSTKEKLMSGSGLGRKFVFEQAAKKTNE
KTRGNYPATVAILEVIQHGLEKGFVKGQELEAKRFGELVMSSESKALRSIFFATTEMKKE
HGTDAKPAAVKKVGVLGGGLMGAGISHVSVARAKVPVRIKDVSNDGVLNALNYNYKLFDK
QRKRRILSKAELQAKMMQLSGGVDFTSFNQIDVVIEAVFEDLDLKQQMVADIEANAKPET
IFATNTSSLPIHKIAEKAERPENIVGLHYFSPVEKMPLVEVIPHETTSDETISTVVALAK
KQGKTPIVVKDKAGFYVNRILAPYMNEAAHILLANEPIEKIDNALLDFGFPVGPITLLDE
VGVDIGAKIMPILVNELGERFKGPDVFDTLLNDGRKGRKSGKGFYTYKGKKKEVDKSVYK
LLKLEPESKLSDNDIALRCVLPMLNEAVRCLDDGIIRSPRDGDIGAIFGIGFPPFLGGPF
RYMDQYGLKELVEKMNEFASKYGDRFAPCDGLLTRAGEERTFY
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaaaaagcatttagtctaaagattgacgagcagaatatcgcttggttggca
attgacgtgcctaatgaaaagatgaacacgctacaggcagcttttgttgaagatatgcag
gaaattttcgcacagctaaaagactcaactggagtgaaagggatgatcattcattccctg
aagccagataactttgttgcgggtgccgatgtacgcatgcttgacgcatgtactaccgca
agcgaagcggaagcattggcaaaacaaggacaagaactcttccaacaattgtctgacctg
ccttatccggtcgttgctgctattcatggcccttgtctcggaggcggcttagagcttgct
ctggcgtgtgactatcgtgtctgtacggaatccgacatcacacgtttaggtctgccagaa
gtacagctaggcttgctaccaggctctggtggtacacagcgacttcctcgactaattggt
ctgctaccttcacttgatttaatcctgacgggtaaacagctccgcgctaaaaaagcgaaa
aagcttggagtagtagatgcctgtgtaccagagactattttgcttgatgtcgctaagcaa
tttatcgacaaaggcaaaagcaaaggtaagaaaaagcagtcgaccaaagaaaagctgatg
tcgggcagcgggttagggcgcaagtttgtatttgagcaagccgcgaagaaaaccaacgaa
aaaacccgaggcaactatcctgctacagtggcgattttggaagtgatccagcatggtttg
gagaaagggttcgttaaaggccaggagcttgaagcgaagcgcttcggcgaactggttatg
agctcagaatcgaaagcgctgcgttccatcttctttgctaccacagagatgaagaaagaa
cacggcacggatgctaagcctgctgccgtgaaaaaagtcggtgtacttggtggtggtttg
atgggtgctggcattagtcatgtctccgttgcgagagctaaagtgccggttcgaattaaa
gatgtgagcaatgacggggtcttaaatgcgctgaactacaactacaagttgttcgacaag
caacgtaagcgtcgcattctctctaaagcggaactccaagcaaaaatgatgcagctttcg
ggtggcgtagacttcaccagtttcaaccagatcgatgtggttattgaggcggtttttgaa
gaccttgatttgaaacagcaaatggtcgcagatattgaagcaaacgcgaagccagagacc
atttttgcgaccaacacatcgtcactgccaatccataaaattgcagaaaaagctgaacgt
ccagagaatattgtcggtctgcactatttcagtccggtagagaaaatgccgctggtggag
gttatcccgcatgaaaccacatcagacgaaaccatttctacggttgttgcgttagccaag
aaacagggcaaaacgccaatcgtggtgaaagacaaagctggcttctacgtaaaccgcatt
cttgcaccttacatgaacgaagctgcgcatatcttgctggcaaacgagccgatagaaaag
atagataacgcgttactggattttggcttcccggttgggccaatcacactgcttgatgaa
gtaggcgtggatattggcgctaaaatcatgccgattctggtcaatgaattgggcgagcga
ttcaaaggtccggatgtattcgatacgttgcttaacgacggccgtaaaggtcgtaagagt
ggcaaaggtttttacacatacaaaggtaagaagaaagaagtcgataagtctgtctataag
ttattgaaacttgagcctgagtctaagctcagcgacaacgatattgcactgcgctgtgtg
ctgccaatgttgaatgaagcggtacgctgtttagatgacggtattattcgttcgccacgc
gatggtgatattggtgcgattttcggtattggcttcccaccatttttgggtggtcctttc
cgttatatggatcagtatggcttgaaagagctggtcgagaaaatgaacgaatttgcatcg
aaatacggtgaccgatttgcaccttgtgacggcttactcacccgagcgggtgaagaacgt
acgttttattaa

DBGET integrated database retrieval system