KEGG   Vibrio sp. EJY3: VEJY3_11475Help
Entry
VEJY3_11475       CDS       T01683                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vej  Vibrio sp. EJY3
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:vej02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:vej02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2555256..2556368)
Genome map
AA seq 370 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSEIINSESRLEVIDVAVNGREAVEKAKSLKPDVITMDIEMPV
MDGITAVREIMAASPTPILMFSSLTHDGAKATLDALEAGALDFLPKKFEDIARNRDEAVS
LLQQRIIQIASKRAFLRRPVARTSSAATTSLTRPLATRDPIPAAPKPRSSVAKYRASGKR
YQLTAIGTSTGGPVALQKILTRLPVNYPHPIVLIQHMPATFTAAFASRLNTLCKIQVKEA
QDGDALQAGVAYLAPGGKQMMVDGRAGVARLRIIDGGDRMNYKPCVDVTFGSAAKVYGDK
VLSLVLTGMGADGREGARMLKSAGSTIWAQDEDSCVVYGMPQAVAKAGISSEDLPLDRIA
ERILVEVGLA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaaagtactagtcgttgatgattcgagttttttccgtcgtcgcgttagcgaa
atcatcaactcagaatcgcgccttgaggtgattgacgttgctgttaacggcagagaagcg
gtagaaaaagccaaatctcttaagcctgacgtcattaccatggacattgaaatgcccgtg
atggatggtatcacggcagttcgtgaaatcatggctgcgtcaccgacgccaatcctgatg
ttttcgtcactgactcatgatggagcgaaagcaacgctggatgcgctggaagcgggcgct
ctggatttcttaccgaaaaaatttgaagacatcgcgcgcaaccgtgatgaggcggtttcg
ctacttcagcaacgtatcattcagattgcgtccaagcgtgctttcttacgtcgtcctgtt
gcccgcacatcttcagcggcaaccacgtcactgactcggccgcttgcgacgcgcgatccg
atcccggctgcaccaaagcctcgctcttcggtggcgaagtatcgagcatccggtaaaaga
tatcagctgacagctatcggcacgtcgacaggtggccctgtggcactgcaaaagattttg
acgcgtttgcctgtgaattatccgcatccgatcgtgcttattcagcacatgccggcaact
tttaccgccgctttcgccagtcgcctgaatacgctgtgcaaaattcaagtgaaagaagcg
caggatggcgatgcattgcaagctggcgtggcgtatctcgctccgggcggtaaacagatg
atggtcgatggccgcgcaggtgtagcgagactacgcattattgatggcggcgatcgaatg
aactacaaaccgtgtgtcgatgtgacctttggttcagctgcgaaagtgtacggtgataaa
gtgctctcgttagtgctcacgggaatgggtgctgatggccgtgaaggcgcacgcatgttg
aaatctgcaggttcaaccatttgggcgcaagacgaagatagctgtgtggtttacggtatg
cctcaggctgttgcgaaagcggggatttcgtctgaagatttacccctggatcgcattgct
gagcgcattctggtcgaagtggggttagcgtag

DBGET integrated database retrieval system