KEGG   Vibrio sp. EJY3: VEJY3_11475Help
Entry
VEJY3_11475       CDS       T01683                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vej  Vibrio sp. EJY3
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vej00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VEJY3_11475
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    VEJY3_11475
Enzymes [BR:vej01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     VEJY3_11475
Two-component system [BR:vej02022]
 CheA family
  CheA-CheYBV
   VEJY3_11475
Bacterial motility proteins [BR:vej02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    VEJY3_11475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2555256..2556368)
Genome map
AA seq 370 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSEIINSESRLEVIDVAVNGREAVEKAKSLKPDVITMDIEMPV
MDGITAVREIMAASPTPILMFSSLTHDGAKATLDALEAGALDFLPKKFEDIARNRDEAVS
LLQQRIIQIASKRAFLRRPVARTSSAATTSLTRPLATRDPIPAAPKPRSSVAKYRASGKR
YQLTAIGTSTGGPVALQKILTRLPVNYPHPIVLIQHMPATFTAAFASRLNTLCKIQVKEA
QDGDALQAGVAYLAPGGKQMMVDGRAGVARLRIIDGGDRMNYKPCVDVTFGSAAKVYGDK
VLSLVLTGMGADGREGARMLKSAGSTIWAQDEDSCVVYGMPQAVAKAGISSEDLPLDRIA
ERILVEVGLA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaaagtactagtcgttgatgattcgagttttttccgtcgtcgcgttagcgaa
atcatcaactcagaatcgcgccttgaggtgattgacgttgctgttaacggcagagaagcg
gtagaaaaagccaaatctcttaagcctgacgtcattaccatggacattgaaatgcccgtg
atggatggtatcacggcagttcgtgaaatcatggctgcgtcaccgacgccaatcctgatg
ttttcgtcactgactcatgatggagcgaaagcaacgctggatgcgctggaagcgggcgct
ctggatttcttaccgaaaaaatttgaagacatcgcgcgcaaccgtgatgaggcggtttcg
ctacttcagcaacgtatcattcagattgcgtccaagcgtgctttcttacgtcgtcctgtt
gcccgcacatcttcagcggcaaccacgtcactgactcggccgcttgcgacgcgcgatccg
atcccggctgcaccaaagcctcgctcttcggtggcgaagtatcgagcatccggtaaaaga
tatcagctgacagctatcggcacgtcgacaggtggccctgtggcactgcaaaagattttg
acgcgtttgcctgtgaattatccgcatccgatcgtgcttattcagcacatgccggcaact
tttaccgccgctttcgccagtcgcctgaatacgctgtgcaaaattcaagtgaaagaagcg
caggatggcgatgcattgcaagctggcgtggcgtatctcgctccgggcggtaaacagatg
atggtcgatggccgcgcaggtgtagcgagactacgcattattgatggcggcgatcgaatg
aactacaaaccgtgtgtcgatgtgacctttggttcagctgcgaaagtgtacggtgataaa
gtgctctcgttagtgctcacgggaatgggtgctgatggccgtgaaggcgcacgcatgttg
aaatctgcaggttcaaccatttgggcgcaagacgaagatagctgtgtggtttacggtatg
cctcaggctgttgcgaaagcggggatttcgtctgaagatttacccctggatcgcattgct
gagcgcattctggtcgaagtggggttagcgtag

DBGET integrated database retrieval system