KEGG   Vibrio sp. EJY3: VEJY3_11675Help
Entry
VEJY3_11675       CDS       T01683                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00300  Lysine biosynthesis
vej01100  Metabolic pathways
vej01120  Microbial metabolism in diverse environments
vej01230  Biosynthesis of amino acids
Module
vej_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    VEJY3_11675
Enzymes [BR:vej01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     VEJY3_11675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AEX22813
UniProt: H2IIC2
Position
1:2594320..2595456
Genome map
AA seq 378 aa AA seqDB search
MTDSPVLALAKDLISRQSVTPEDAGCQDLMIERLKALGFEIEVMVFEDTTNFWARRGTEA
PLFAFAGHTDVVPAGKLEQWDTHPFEPTIIDGYLHGRGAADMKGSLAAMIVAVERFIAEN
PDHKGSIGFLITSDEEGPFINGTVRVVEALMERGENIDMCIVGEPSSTEIVGDVVKNGRR
GSITGDLTVKGTQGHVAYPHLANNPVHSSLLAIHELATTEWDKGNDYFPPTSFQIPNVSA
GTGASNVIPGEFNVQFNLRFSTELNNDTIVQRVTETLDKHALDYELNWTFNGDPFLTDTG
ALLDAVVAAVNEVNHTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKVDD
LEKLTDMYQNTLKHLLAK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacagacagtccagtactggctcttgcgaaagacctaatcagcagacaatccgtaacg
cctgaagacgcgggctgccaggacttaatgatcgagcgactaaaagcgcttggttttgaa
atcgaagtcatggtgtttgaagatacaaccaacttttgggctcgccgtggcaccgaagca
ccgctatttgcctttgctggccacactgacgtagtgcctgcgggcaagcttgaacaatgg
gatacgcatccatttgagccaacaataatcgatggctacctgcatggtcgcggtgcggcg
gatatgaaaggctctctggcggcaatgattgtcgctgtggaacgttttattgcagagaac
cctgatcataaaggctctatcggctttttgattacttcagatgaagaaggtcctttcatc
aacggtaccgttcgcgtggtagaggcgctgatggaacgtggtgaaaacattgatatgtgt
atcgtgggtgaaccttcaagtaccgagatcgttggtgatgtcgtgaaaaatggtcgccgt
ggttcaatcactggtgacctgacggttaaaggtactcagggacacgttgcttacccacat
ctggctaataaccctgttcactcttctctgttagccattcacgagttagcaaccacggaa
tgggataagggtaacgactacttcccgccaaccagcttccagattccaaacgtgtcggca
ggtaccggtgcttcaaacgtcattccgggcgagttcaatgttcaattcaacctgcgtttt
agcacagagttgaataacgacactattgttcaaagagtgacagaaacgctagacaagcat
gccctggactatgagctgaactggacgttcaacggtgacccattcttaaccgacacaggc
gcgttactggacgccgtcgttgctgcagtaaatgaagtaaaccacaccaaaccagcacta
ctgacaactggcggaacttcggatggccgttttattgctcgaatgggtggtcaagtcgtg
gaacttggtcctgtgaatgcaaccattcataaagtgaacgagtgcgtgaaagtagatgac
ttagaaaagttaacggacatgtaccaaaatacgcttaagcatttattggcgaagtaa

DBGET integrated database retrieval system