KEGG   Vibrio sp. EJY3: VEJY3_12595Help
Entry
VEJY3_12595       CDS       T01683                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vej  Vibrio sp. EJY3
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VEJY3_12595 (deoA)
Enzymes [BR:vej01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     VEJY3_12595 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2799801..2801129)
Genome map
AA seq 442 aa AA seqDB search
MYLPQEIIRKKRDGEVLSADEINFFIQGVANNTVSEGQIAAFAMTIFFNEMTMDERIALT
CAMRDSGMVIDWSHMNFGGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPMISGRGLGHT
GGTLDKLESIPGYNITPTNDVFGQVTKDAGVAIIGQTGDLAPADKRVYATRDITATVDNI
SLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTAILT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMASCAEMLVLGKLAENTDDARAKL
MEVLDNGKAAECFGKMVAGLGGPADFVENYENYLEKAEIIKPVYATETGIVSAMDTRAIG
MAVVAMGGGRRVATDEIDYAVGFDEFIRLGEVADSDKPLAVIHARSEEQWEEAAKALRSA
IKVGGEYTPTPEVYRQIRAEDI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaccgcaagaaatcattcgtaaaaaacgtgacggcgaagttctttctgctgac
gaaatcaacttctttattcaaggtgtagcgaacaacacagtatctgaaggtcagatcgcg
gcgtttgctatgactattttcttcaatgaaatgaccatggatgagcgtattgccctgact
tgtgcaatgcgcgattcaggcatggttatcgactggagccacatgaactttggcggccct
attgtcgataagcactctacaggtggcgtgggtgatgtgacctccctcatgcttggccca
atggtggcggcgtgtggtggtttcgtaccaatgatctctggccgtggccttggtcatact
ggcggtacgctcgataaattagagtcaatcccaggctacaatatcacgccaactaacgac
gtatttggtcaagtgacgaaagatgctggcgttgcgattatcggccaaacgggcgatctc
gctccggcagataagcgcgtgtacgcaacccgagatatcacggctaccgttgataacatt
tccctaattacggcatcgattctgtctaagaaattggctgcgggcttggaatctctagtg
atggacgtaaaagtcggctcgggcgcattcatgccaacttatgaagcatcagaagagcta
gccaaatctatcgttgcggtagcaaatggcgctggcacaaaaacaacagcaatcctgaca
gacatgaaccaggttctagcgtcttcagccggtaatgcggttgaagtacgtgaagcggtt
cgtttcctgactggtgaataccgaaatccacgtctgcttgaagtcacaatggcgtcgtgt
gcggaaatgttggtgcttggtaagctggcagaaaatacagatgacgcacgtgcgaaactg
atggaagtgctcgacaacggtaaagcggcagaatgcttcggcaagatggttgcaggtcta
ggcggcccagcagacttcgtagaaaactacgaaaactacctagaaaaagcagaaatcatc
aaaccagtgtatgcgacggaaacaggcattgtctctgcgatggacacacgtgctatcggt
atggctgtggtcgcgatgggcggtggtcgccgcgttgcaacggatgaaatcgactacgcg
gttggttttgatgagttcatccgtttgggtgaggtcgctgatagtgataagcctctggct
gttatccacgctcgcagtgaagagcagtgggaagaagcggcaaaagcactacgcagtgca
atcaaagttggtggtgaatatacaccaaccccagaggtttaccgtcagattcgtgcagaa
gatatctag

DBGET integrated database retrieval system