KEGG   Vibrio sp. EJY3: VEJY3_12720Help
Entry
VEJY3_12720       CDS       T01683                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
vej  Vibrio sp. EJY3
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vej00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2827808..2828641)
Genome map
AA seq 277 aa AA seqDB search
MIIKVKNKSLDLSRPHVMAILNVTPDSFSDGGKFNSLDLALARVEKMIKAGVSIIDVGGE
STRPGAPEVTLEDELERVIPVVRAIRAHYPDVWISVDTSKAEVIRQSVEAGADLINDIRS
LTEPGALEVAAKANVPVCIMHMKGQPKTMQQNPQYDDLMQEVEQFLVERMAVCEAAGIAR
ENIILDLGFGFGKTIEHNYHMLAHLEKFHKFGLPILAGLSRKSMIFKLLDKPAAECTNAS
VVCATIAAMKGAQIIRVHDFEETLEAMKVVEMTKNNI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgattattaaagtaaaaaacaaatctctggacctttctcgtccacacgtaatggccatt
ctcaacgtcacgccagattccttctctgatggaggcaagttcaattctctagatttagcg
cttgcacgcgttgagaaaatgataaaagcaggcgtcagcattattgatgttggcggtgaa
tcgacccgaccgggagctccggaagtcacgttggaagatgaactggagcgcgttattcca
gtcgttagagctatcagagcgcactaccccgacgtgtggatatcagttgataccagtaaa
gctgaagtgattcgtcagtctgttgaagctggtgcggatcttatcaatgacattcgttct
ttgactgagcctggtgcattggaagtggctgcaaaagcgaatgtaccggtgtgcatcatg
catatgaaaggccagcctaaaaccatgcaacagaacccgcaatatgatgatctcatgcag
gaagtggagcagttcctggtggagcgaatggcagtgtgcgaagccgcaggtatcgcgcga
gaaaatatcattctcgatcttggttttggctttggcaaaaccatagaacacaattatcat
atgctggctcatcttgagaagtttcataaatttggcttgccaatcttggcaggcttgtct
cgtaaatcgatgatttttaaactgttggataagcctgcggcagagtgcacaaacgctagt
gttgtttgtgccacgattgcagcgatgaaaggtgcacagatcattcgagtacacgacttt
gaagaaacgcttgaagcgatgaaagttgttgagatgacgaagaacaatatttaa

DBGET integrated database retrieval system