KEGG   Vibrio sp. EJY3: VEJY3_12850Help
Entry
VEJY3_12850       CDS       T01683                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vej  Vibrio sp. EJY3
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vej00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:vej00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2861346..2863010
Genome map
AA seq 554 aa AA seqDB search
MEYRVDLVVLSELKQNCRFGLTFHNLSDQDLHDWHLTFAFDRFILPDSVSNGVLNQVGSF
CTLKPESMVLAANHNFYCEFSIGSNPFRYYSDGLNEALVDFVVNGNTQRAEVDVTPIVLA
SPYRERSDIPPSLIHAQPLLPKPNHIEVHESYFSLHNRVGISTYSDLANSAKDWLLDELK
RIHQFELTASNNSQVIFKSNPTLDKGAYRLKVTEESIKIEAGSKSGFTHASATLLQLIRR
NGEDTSMEVVCCSIKDRPRFKYRGMMLDCARHFHSVEQVKRLINQLAHYKFNTFHWHLTD
DEGWRIEIKSLPELTNIGAWRGLDESIEPQYTHLSQRYGGFYTQEEIKEVVAYAARRSIT
VIPEIDVPGHCRAAIKSLPHMLVEAEDTTEYRSIQHYNDNVINPALPGSYEFIDKVLEEV
VALFPAPYIHIGADEVPHGVWSQSPACQALMEQQGYSDYKELQGHFLRHAEDKLRGLGKR
MLGWEEAQHGNKVSKDTVIYSWLSEEAALNCARQGFDVVLQPAQTTYLDMTQDYAPEEPG
VDWANPIPLETAYS
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggaatatcgcgttgacctcgtcgtcctatctgagctaaagcaaaattgtcgctttgga
ctaacttttcataacttaagtgaccaagatcttcatgattggcacctgacgtttgctttt
gatcgcttcattttacctgacagcgtatctaacggtgtacttaaccaagttgggagcttc
tgtactctcaaaccagaaagtatggtactggcggctaatcacaatttctattgtgagttc
agtattggttcaaatccatttcgctattattcagacgggctaaatgaagctctggttgat
tttgtcgtcaatggtaatacccagcgagccgaggttgacgtaacacctatcgtgctggct
tcgccataccgcgagcgtagtgacattccaccgagtttgattcacgctcagcctttatta
cctaagccaaaccatattgaagttcacgagagttatttttctcttcacaaccgtgttgga
atcagtacttactccgatttagccaattcagcaaaagattggttgctcgatgaactaaaa
cgtattcaccagtttgagcttactgcgtctaataacagtcaggttatctttaaaagtaat
ccaactctagataaaggtgcgtataggctcaaagtgaccgaagaatcgataaaaatcgag
gctggttcaaagtctggattcacccatgctagtgcgaccctgctccaacttatcagaaga
aatggggaagatacttctatggaagtggtctgttgctcaattaaagacagacctcgtttc
aaatatcgcggaatgatgctcgattgtgcacgacacttccattccgtagagcaagtgaaa
cgtcttatcaaccaactggcacactacaagtttaataccttccactggcatcttactgac
gatgaaggctggcgaatcgagattaaatccctgccagagctgacaaatattggggcatgg
cgcgggttagatgagtccattgaaccgcaatatacacatttgtctcagcgttatggcggg
ttttatacccaagaagaaataaaagaagtggttgcctatgcggcgcggcgcagtattacc
gtcatccctgaaattgacgtaccaggccactgtcgcgccgccattaaatcactacctcac
atgcttgtagaggcagaagacaccaccgaatatcgcagtattcagcactacaacgataac
gtgattaacccagcgctaccgggcagttacgaatttatcgacaaagtactggaagaagtt
gtcgctttattccctgcaccatatatccacattggggccgatgaagtaccacatggtgtc
tggtcgcaaagcccagcctgtcaggcgttgatggagcaacaaggctatagcgactacaaa
gaactgcaaggtcacttcttgcgtcatgcggaagacaaacttcgcgggcttggtaaacga
atgctgggatgggaagaagctcagcatggcaacaaggttagtaaagataccgttatctac
tcatggctaagtgaagaagcggctctcaattgtgctcgccaaggcttcgatgtggtgctg
caacccgcccaaaccacctacttggatatgactcaagactacgcgccagaagaacctgga
gtggattgggcaaacccgattccactggagacagcgtatagctag

DBGET integrated database retrieval system