KEGG   Vibrio sp. EJY3: VEJY3_13575Help
Entry
VEJY3_13575       CDS       T01683                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
vej  Vibrio sp. EJY3
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VEJY3_13575
   00240 Pyrimidine metabolism
    VEJY3_13575
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VEJY3_13575
   03430 Mismatch repair
    VEJY3_13575
   03440 Homologous recombination
    VEJY3_13575
Enzymes [BR:vej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VEJY3_13575
DNA replication proteins [BR:vej03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     VEJY3_13575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3033852..3034301
Genome map
AA seq 149 aa AA seqDB search
MQTATFYIIKEDSPQAQLTGFEEYVVFLAQHFARQGAKVYLNCNDKMHAEQLAEAFWQID
ADKFMAHNLVGEGPKYATNIEIGHHGVKPSWNRQLVINLAENETTFANKFAQVVDFVPCE
EKAKQLARERYKIYRQAGYQLQTIEIQYP
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgcaactttctacatcatcaaagaagacagcccacaagcgcagctcactggc
tttgaagagtatgtcgtatttttggctcagcactttgcccgccaaggcgctaaagtatat
ctgaactgcaacgacaaaatgcatgccgagcagctcgctgaagctttctggcaaattgat
gcagacaagttcatggcacataatctcgtaggtgaaggccctaaatacgccaccaacatt
gaaattggacatcatggtgtaaaaccgtcttggaatcgccaattagtaattaatttggcg
gaaaatgagacaacctttgcgaacaagtttgctcaagtggtagacttcgtgccctgcgaa
gaaaaagctaaacagctcgcaagagaaagatataaaatttaccgacaagcaggctaccaa
ctgcagacgatagaaattcaatatccttaa

DBGET integrated database retrieval system