KEGG   Vibrio sp. EJY3: VEJY3_13895Help
Entry
VEJY3_13895       CDS       T01683                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00040  Pentose and glucuronate interconversions
vej00052  Galactose metabolism
vej00500  Starch and sucrose metabolism
vej00520  Amino sugar and nucleotide sugar metabolism
vej01100  Metabolic pathways
vej01130  Biosynthesis of antibiotics
Module
vej_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VEJY3_13895
   00052 Galactose metabolism
    VEJY3_13895
   00500 Starch and sucrose metabolism
    VEJY3_13895
   00520 Amino sugar and nucleotide sugar metabolism
    VEJY3_13895
Enzymes [BR:vej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VEJY3_13895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AEX23253
UniProt: H2ICZ2
Position
1:3101659..3102531
Genome map
AA seq 290 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMNGMCIVTGRGKH
SIMDHFDKNYELEHQISGTNKEELLVDIREIIESANFTYIRQREMKGLGHAILTGRELVG
DEPFAVVLADDLCVNEDEGVLAQMVALFKQFRCSIVAVQEVPVEETHKYGVISGEMIKDD
IFRVDDMVEKPEKGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALLKQAKAG
CVLAYKFKGKRFDCGSVEGYIEATNYCFENLYLKDEKKSELGKHATQREA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgtctgttccctgctgcaggctatggtacgcgcttcttacctgcgacc
aagtcaatgccaaaagagatgatgccggtagtgaacaagccattaattgaatatggcgtt
gaagaagcgattcaagctggtatgaacggcatgtgtattgtgactggtcgtggcaaacac
tcaatcatggatcactttgataaaaactacgaactcgagcaccaaatcagcggcactaac
aaagaagagctgttggtagacattcgtgaaatcattgagtcagctaactttacctacatc
cgtcaaagagagatgaaaggtttgggacacgcgatcctgactggtcgtgagctggttggt
gatgaaccttttgctgttgttttagctgatgacctttgtgtcaatgaagacgaaggcgtt
ctggctcaaatggtcgcgcttttcaaacagttccgctgctctattgttgcggtgcaggaa
gtcccagtagaagaaactcataaatacggcgttatctcaggcgagatgatcaaagatgat
atcttccgtgtggatgacatggttgaaaaaccagagaaaggcacagcgccaagtaacctg
gccatcatcggccgttacatcctgactcctgacattttcgagttaattgaaaacacagag
ccaggaaaaggtggtgaaattcagattactgatgccctactaaagcaagcgaaagctggc
tgcgtacttgcgtacaaattcaaaggtaagcgattcgattgtggtagcgtagaaggttac
atcgaagcaacgaattactgtttcgaaaacctgtacctaaaagacgagaagaagtctgag
ctaggcaaacacgcgactcaacgcgaagcataa

DBGET integrated database retrieval system