KEGG   Vibrio sp. EJY3: VEJY3_14520Help
Entry
VEJY3_14520       CDS       T01683                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vej  Vibrio sp. EJY3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEJY3_14520
   01230 Biosynthesis of amino acids
    VEJY3_14520
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VEJY3_14520
   00030 Pentose phosphate pathway
    VEJY3_14520
   00051 Fructose and mannose metabolism
    VEJY3_14520
   00052 Galactose metabolism
    VEJY3_14520
  Energy metabolism
   00680 Methane metabolism
    VEJY3_14520
Enzymes [BR:vej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VEJY3_14520
Protein phosphatases and associated proteins [BR:vej01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VEJY3_14520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3247209..3248171)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAVRGVVRTALSEGLEVFGVYDGYLGLYEGRIEKLDRSSVSD
VINKGGTFLGSARFPEFKEVAVREKAIENLKKHGIDALVVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIDAIDRLRDTSSSHQRISIVEIMGRHCGDLTLM
SAIAGGCEYIITPETGLDKEKLIGNIQDGIAKGKKHAIIALTELMMDANELARDIETATG
RETRATVLGHIQRGGRPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIVKEQLVHHDIIDA
IENMKRPVRNDLYKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagatcggtgttttaacaagtggcggtgacgcacctggtatgaacgctgca
gtacgcggcgtggtacgcacagcactttctgaaggattggaagtgtttggtgtgtacgat
ggctacctaggtctttatgaaggccgcatcgagaagctagatcgttctagtgtttctgat
gttattaacaaaggtggtacgttcctgggttctgcacgtttccctgagttcaaggaagtg
gcagtacgcgaaaaagctattgagaacctgaagaaacacggtatcgacgcactggtagtg
attggtggtgacggttcttacatgggtgcaaagaaactgactgaaatgggttacccatgt
atcggtctgccaggcactatcgataacgacattgcgggtacggattacactatcggttac
ctaactgcactaaacacagttattgatgcaatcgaccgtctacgtgacacttcttcatct
caccaacgtatttcaattgtagaaatcatgggccgtcactgtggtgacctgactctgatg
tctgctatcgctggtggttgtgagtacatcatcacaccagaaacgggtcttgataaagag
aagctgatcggcaacattcaagacggtatcgcaaaaggtaagaaacacgcaatcattgct
cttactgaactgatgatggatgcaaacgagcttgctcgtgatattgaaacggcaacaggt
cgcgaaacgcgtgcgacagtacttggtcacatccaacgtggtggtcgtcctactgcattt
gaccgtgttcttgcatctcgcatgggtaactacgctgttcaccttctaatggaaggtcac
ggtggccgttgtgttggtatcgtgaaagagcagcttgttcatcacgatattattgatgcg
atcgaaaacatgaagcgccctgtacgtaatgacttgtacaaggttgcagaagagctgttc
taa

DBGET integrated database retrieval system