KEGG   Vibrio sp. EJY3: VEJY3_14520Help
Entry
VEJY3_14520       CDS       T01683                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00010  Glycolysis / Gluconeogenesis
vej00030  Pentose phosphate pathway
vej00051  Fructose and mannose metabolism
vej00052  Galactose metabolism
vej00680  Methane metabolism
vej01100  Metabolic pathways
vej01110  Biosynthesis of secondary metabolites
vej01120  Microbial metabolism in diverse environments
vej01130  Biosynthesis of antibiotics
vej01200  Carbon metabolism
vej01230  Biosynthesis of amino acids
vej03018  RNA degradation
Module
vej_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VEJY3_14520
   00030 Pentose phosphate pathway
    VEJY3_14520
   00051 Fructose and mannose metabolism
    VEJY3_14520
   00052 Galactose metabolism
    VEJY3_14520
  Energy metabolism
   00680 Methane metabolism
    VEJY3_14520
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VEJY3_14520
Enzymes [BR:vej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VEJY3_14520
Protein phosphatases and associated proteins [BR:vej01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VEJY3_14520
Messenger RNA biogenesis [BR:vej03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     VEJY3_14520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEX23378
UniProt: H2IE88
Position
1:complement(3247209..3248171)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAVRGVVRTALSEGLEVFGVYDGYLGLYEGRIEKLDRSSVSD
VINKGGTFLGSARFPEFKEVAVREKAIENLKKHGIDALVVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIDAIDRLRDTSSSHQRISIVEIMGRHCGDLTLM
SAIAGGCEYIITPETGLDKEKLIGNIQDGIAKGKKHAIIALTELMMDANELARDIETATG
RETRATVLGHIQRGGRPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIVKEQLVHHDIIDA
IENMKRPVRNDLYKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagatcggtgttttaacaagtggcggtgacgcacctggtatgaacgctgca
gtacgcggcgtggtacgcacagcactttctgaaggattggaagtgtttggtgtgtacgat
ggctacctaggtctttatgaaggccgcatcgagaagctagatcgttctagtgtttctgat
gttattaacaaaggtggtacgttcctgggttctgcacgtttccctgagttcaaggaagtg
gcagtacgcgaaaaagctattgagaacctgaagaaacacggtatcgacgcactggtagtg
attggtggtgacggttcttacatgggtgcaaagaaactgactgaaatgggttacccatgt
atcggtctgccaggcactatcgataacgacattgcgggtacggattacactatcggttac
ctaactgcactaaacacagttattgatgcaatcgaccgtctacgtgacacttcttcatct
caccaacgtatttcaattgtagaaatcatgggccgtcactgtggtgacctgactctgatg
tctgctatcgctggtggttgtgagtacatcatcacaccagaaacgggtcttgataaagag
aagctgatcggcaacattcaagacggtatcgcaaaaggtaagaaacacgcaatcattgct
cttactgaactgatgatggatgcaaacgagcttgctcgtgatattgaaacggcaacaggt
cgcgaaacgcgtgcgacagtacttggtcacatccaacgtggtggtcgtcctactgcattt
gaccgtgttcttgcatctcgcatgggtaactacgctgttcaccttctaatggaaggtcac
ggtggccgttgtgttggtatcgtgaaagagcagcttgttcatcacgatattattgatgcg
atcgaaaacatgaagcgccctgtacgtaatgacttgtacaaggttgcagaagagctgttc
taa

DBGET integrated database retrieval system