KEGG   Vibrio sp. EJY3: VEJY3_15010Help
Entry
VEJY3_15010       CDS       T01683                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
vej  Vibrio sp. EJY3
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VEJY3_15010
Enzymes [BR:vej01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VEJY3_15010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3365880..3366881
Genome map
AA seq 333 aa AA seqDB search
MATHHSPTTYTQENLFGQAIGGPIAELWQSRQEGFVKGTEKKKIYWCKLTHPEHKKAVLV
VNGRIESSWKYQELFYDFYRQGYDVYSFDHRGQGLSDRLLEDSDMGHVYDFADYVEDMDI
VIKKHDLGHYDQCFIVAHSMGGAIATRYLQTHPKHHFTGLILSAPMFGINLPWYLSPIAL
PVTQILSAVSTLPRYAPGHQPYFPKPFENNLLSQSHDRYRWFRGLYSDMPELQVGGPSTR
WVWQGLMAAKQCFLLTRQVKIPVLLIQAGEDRIVSNLAQKRFIDKLSKTNPNADLVSVEG
AHHEILFEADKYRNQALDAIFRFMKQPKPSSVS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggctactcaccattcccctacgacttatactcaagagaacttatttgggcaagcgata
ggtggtccgatcgctgaactctggcaaagtcgccaagaaggctttgtgaaagggacagaa
aaaaagaaaatctactggtgcaaactcacccaccctgaacacaaaaaagcggtgctggtt
gttaatggacgaatcgagtcttcctggaaataccaagaactgttttatgatttctaccgc
caaggttacgacgtttactcatttgaccaccgtgggcaaggattatccgaccggctacta
gaagactcggacatgggtcacgtctacgactttgcagactatgttgaagatatggacata
gtgataaaaaagcacgatctcggccactatgaccagtgttttatcgtcgcgcactccatg
ggcggagccatcgccactcgatatcttcaaactcacccgaagcatcatttcacagggttg
attttaagtgcaccgatgttcgggattaacctgccgtggtacttatctccgattgcccta
ccggtgacccaaattctttcggcagtatcaacgctgccacgttatgcgcctggtcatcag
ccgtacttccccaaaccgtttgagaataatctcctcagccagagccatgatcgctatcgt
tggtttcgtggactttattcagacatgccggagctacaagtcggtggaccaagtacccgc
tgggtatggcaagggctgatggcagccaaacaatgctttttattaacacgtcaggtaaaa
atacccgtgctgcttattcaagccggagaagatcgtattgtcagtaatctggcccagaaa
cgttttattgataagttgagtaaaaccaacccgaatgccgatctggtatccgtagaagga
gctcatcatgaaattttgttcgaagccgataaataccgtaatcaggctctggatgcgatt
ttccgttttatgaaacagcctaagccttcttccgtttcataa

DBGET integrated database retrieval system