KEGG   Vibrio sp. EJY3: VEJY3_16331Help
Entry
VEJY3_16331       CDS       T01683                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vej  Vibrio sp. EJY3
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vej00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(115043..115969)
Genome map
AA seq 308 aa AA seqDB search
MNDLFTKTDYSLYSNSMSFLRLPYIKNPVTAEADVVVLGVPLDMATSGRSGARMGPDAIR
RASVNLAWEGKKFPWDFNVFDKLTVIDSGDLVFDCGDAEDFTYRLEAATSEILKSEKTML
ALGGDHFITLPILRAYAKHYGEMALVHFDAHTDTYANGSSYDHGTMFYHAPKEGLISAKN
SVQIGIRTEYKQQDHGFNVINAMQANDMSVNEILDEIRRTVADKPVYVTFDIDCLDPAFA
PGTGTPVCGGLNTDKVLKIIRGLAGMNIVGMDVVEVSPPYDQSDVTALAGATIALELLYA
YASGREQA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttgtttactaaaactgattattcgctttactccaactcaatgtcgtttctg
cgtcttccgtacattaaaaatccggtgactgcggaggcagacgttgtggtactcggcgtt
cctctcgacatggcaacatctggtcgttcaggggctcgcatgggtccggatgctatccgt
cgcgcttctgtaaatttagcctgggaaggtaaaaaattcccttgggatttcaacgtattt
gataagttaaccgtcattgattccggagacttggtcttcgattgcggtgacgcagaagac
ttcacttaccgtttggaagcggcgacaagcgaaatcttaaaaagcgagaaaacaatgctt
gcactggggggggatcatttcatcacccttccgattctgcgtgcttatgcgaaacattat
ggcgaaatggcgctagttcatttcgatgctcatacagacacatacgcgaacggcagctca
tacgaccacggtacgatgttctaccatgcaccgaaagaagggctaatttctgcgaagaac
tcagtacaaattggtattcgtactgagtacaaacagcaagatcacggctttaacgttatt
aatgcgatgcaagccaatgacatgtctgtgaatgagattctagacgagattcgtcgtacc
gttgctgataagccagtatacgttacctttgatatagactgcttagatccagcatttgct
ccgggaacgggaacgccggtttgcggcggtttaaatactgacaaggtgcttaaaatcatt
cgtggtttggctggcatgaatatcgtaggcatggacgtggtagaagtgtcaccaccttat
gaccaaagtgatgtcaccgcattagcaggcgcgaccattgctctagaactgctgtacgct
tacgcatcaggtcgagaacaagcctaa

DBGET integrated database retrieval system