KEGG   Vibrio sp. EJY3: VEJY3_16426Help
Entry
VEJY3_16426       CDS       T01683                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00620  Pyruvate metabolism
vej00630  Glyoxylate and dicarboxylate metabolism
vej01100  Metabolic pathways
vej01110  Biosynthesis of secondary metabolites
vej01120  Microbial metabolism in diverse environments
vej01200  Carbon metabolism
Module
vej_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEJY3_16426
   00630 Glyoxylate and dicarboxylate metabolism
    VEJY3_16426
Enzymes [BR:vej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VEJY3_16426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B3
Motif
Other DBs
NCBI-ProteinID: AEX23706
UniProt: H2IJF8
Position
2:137374..137952
Genome map
AA seq 192 aa AA seqDB search
MNMLNFDNKEMQQQQRPFIAEAVFAVEAVSAEQQSEKQVKAKQLLDRMFPLENGSHQDVS
SYVIDYRHVLAYFKDGSHSGLASPKHFVAYTGEKEDPKSILLKDESGNHVEVMFGCHKGT
GCVELMDIDDIQLETRITFNPELTGNAPTAMRHWISLVKGDKKGKPMACSEDKEYTAKNG
EDYVLSYCYNVD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgaacttcgataataaagaaatgcaacaacaacaacgcccatttatcgct
gaagctgtatttgccgtcgaagcggtgagtgctgagcaacagagcgaaaaacaagtaaaa
gcgaagcaactacttgaccgtatgttccctttggagaacgggtcacaccaagacgtatca
agctacgtaattgattaccgtcatgtactagcttactttaaagacggttctcacagcggt
ctggcaagtccaaaacattttgtggcgtacactggtgagaaagaagatcctaaatcgatt
ttgcttaaagatgagtcaggtaaccatgttgaagtaatgttcggttgtcacaaaggtacg
ggatgtgttgaactgatggacattgatgacattcagttagaaactcgcatcacgtttaac
cctgaactgactggtaatgcgccaacggcaatgcgtcactggattagcctggtaaaaggt
gacaagaaaggtaagccgatggcttgcagtgaagacaaagaatacacggctaaaaatggt
gaagattacgttctgagctactgctacaacgtcgactaa

DBGET integrated database retrieval system