KEGG   Vibrio sp. EJY3: VEJY3_16426Help
Entry
VEJY3_16426       CDS       T01683                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
vej  Vibrio sp. EJY3
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEJY3_16426
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEJY3_16426
   00630 Glyoxylate and dicarboxylate metabolism
    VEJY3_16426
Enzymes [BR:vej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VEJY3_16426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:137374..137952
Genome map
AA seq 192 aa AA seqDB search
MNMLNFDNKEMQQQQRPFIAEAVFAVEAVSAEQQSEKQVKAKQLLDRMFPLENGSHQDVS
SYVIDYRHVLAYFKDGSHSGLASPKHFVAYTGEKEDPKSILLKDESGNHVEVMFGCHKGT
GCVELMDIDDIQLETRITFNPELTGNAPTAMRHWISLVKGDKKGKPMACSEDKEYTAKNG
EDYVLSYCYNVD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgaacttcgataataaagaaatgcaacaacaacaacgcccatttatcgct
gaagctgtatttgccgtcgaagcggtgagtgctgagcaacagagcgaaaaacaagtaaaa
gcgaagcaactacttgaccgtatgttccctttggagaacgggtcacaccaagacgtatca
agctacgtaattgattaccgtcatgtactagcttactttaaagacggttctcacagcggt
ctggcaagtccaaaacattttgtggcgtacactggtgagaaagaagatcctaaatcgatt
ttgcttaaagatgagtcaggtaaccatgttgaagtaatgttcggttgtcacaaaggtacg
ggatgtgttgaactgatggacattgatgacattcagttagaaactcgcatcacgtttaac
cctgaactgactggtaatgcgccaacggcaatgcgtcactggattagcctggtaaaaggt
gacaagaaaggtaagccgatggcttgcagtgaagacaaagaatacacggctaaaaatggt
gaagattacgttctgagctactgctacaacgtcgactaa

DBGET integrated database retrieval system