KEGG   Vibrio sp. EJY3: VEJY3_16426Help
Entry
VEJY3_16426       CDS       T01683                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vej  Vibrio sp. EJY3
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VEJY3_16426
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEJY3_16426
   00630 Glyoxylate and dicarboxylate metabolism
    VEJY3_16426
Enzymes [BR:vej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VEJY3_16426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:137374..137952
Genome map
AA seq 192 aa AA seqDB search
MNMLNFDNKEMQQQQRPFIAEAVFAVEAVSAEQQSEKQVKAKQLLDRMFPLENGSHQDVS
SYVIDYRHVLAYFKDGSHSGLASPKHFVAYTGEKEDPKSILLKDESGNHVEVMFGCHKGT
GCVELMDIDDIQLETRITFNPELTGNAPTAMRHWISLVKGDKKGKPMACSEDKEYTAKNG
EDYVLSYCYNVD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgaacttcgataataaagaaatgcaacaacaacaacgcccatttatcgct
gaagctgtatttgccgtcgaagcggtgagtgctgagcaacagagcgaaaaacaagtaaaa
gcgaagcaactacttgaccgtatgttccctttggagaacgggtcacaccaagacgtatca
agctacgtaattgattaccgtcatgtactagcttactttaaagacggttctcacagcggt
ctggcaagtccaaaacattttgtggcgtacactggtgagaaagaagatcctaaatcgatt
ttgcttaaagatgagtcaggtaaccatgttgaagtaatgttcggttgtcacaaaggtacg
ggatgtgttgaactgatggacattgatgacattcagttagaaactcgcatcacgtttaac
cctgaactgactggtaatgcgccaacggcaatgcgtcactggattagcctggtaaaaggt
gacaagaaaggtaagccgatggcttgcagtgaagacaaagaatacacggctaaaaatggt
gaagattacgttctgagctactgctacaacgtcgactaa

DBGET integrated database retrieval system